KEGG   Phenylobacterium zucineum: PHZ_c2824Help
Entry
PHZ_c2824         CDS       T00750                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu00010  Glycolysis / Gluconeogenesis
pzu00620  Pyruvate metabolism
pzu00640  Propanoate metabolism
pzu00680  Methane metabolism
pzu01100  Metabolic pathways
pzu01110  Biosynthesis of secondary metabolites
pzu01120  Microbial metabolism in diverse environments
pzu01130  Biosynthesis of antibiotics
pzu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHZ_c2824
   00620 Pyruvate metabolism
    PHZ_c2824
   00640 Propanoate metabolism
    PHZ_c2824
  Energy metabolism
   00680 Methane metabolism
    PHZ_c2824
Enzymes [BR:pzu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PHZ_c2824
Lipid biosynthesis proteins [BR:pzu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PHZ_c2824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACG79233
UniProt: B4R8B5
Position
3239382..3241328
Genome map
AA seq 648 aa AA seqDB search
MSHDQSFPPPAAWARDALVDRRRYEDLVALEARDPDAFWREVAGRLDWETPFTKVKDVSF
DLTDFRIRWFEDGRLNASVNCIDRHLAARGDQTAIIWEGDDPAASRRITYRELHRQVCRM
ANVLKRRGVRRGDRVTIYLPMIPEAAYAMLACARIGAIHSVVFAGFSPDSLAGRINDCDS
RLVITADEGVRGGKRVPLKANVDEALEHAPGVETVLVVTRTGVATSLKAGRDFVYEAEAA
EVADDCPAEAMGAEDPLFILYTSGSTGRPKGVLHTTGGYLAWAAWTHEAVFDYRPGQVYW
CTADVGWVTGHSYIVYGPLANGATTLMFEGVPNYPSLSRCWQVIDKHQVEIFYTAPTAIR
ALMREGEAPVARTSRRSLRLLGSVGEPINPEAWLWYHRVVGEHRCPIVDTWWQTETGGIL
ISPLPGATTLKPGSATRPLPGVKLALVDADGRPLEGAGEGNLCLTDSWPGQMRTVWNDHE
RFLQTYFSTYPGKYFTGDGCRRDADGDYWITGRVDDVLNVSGHRLGTAEVESALVAHPKV
AEAAVVGFPHEVKGQGIYCYVTLKAGEQPGPALEKALVDWVRREIGPIATPDVIQWAPGL
PKTRSGKIMRRILRKIAEGDTANLGDTSTLADPGVVDDLVARKRLEPA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgagccacgaccagtccttcccgcctcccgccgcctgggcccgcgacgccctggtggac
cggcggcgatacgaggacctcgtggccctggaggcccgcgaccccgacgccttctggcgc
gaggtggccgggcggctcgactgggagacgcccttcaccaaggtgaaggacgtcagcttc
gaccttacggacttccgcatccgctggttcgaggacgggcggctcaacgcgtcggtcaac
tgcatcgaccggcacctggcggcgcgcggcgaccagacggcgatcatctgggagggggac
gatcccgccgcgagccgccgcatcacctaccgcgagctgcaccgccaggtgtgccggatg
gccaacgtcctcaagcggaggggcgtccgccggggcgaccgggtgacgatctacctgccg
atgatcccggaggcggcctacgccatgctggcctgcgcccggatcggcgcgatccactcg
gtcgtcttcgcgggcttctcgcccgacagcctggcgggacggatcaacgactgcgactcc
cgcctcgtcatcaccgccgacgaaggcgttcgcggcggcaagcgcgtcccgctgaaggcg
aatgtggacgaggcgctggagcatgcgcccggggtcgagaccgtgctggtcgtcacccgc
accggcgtcgccacctcgctgaaagccggccgcgacttcgtctacgaggccgaggccgcc
gaggtcgccgacgactgccccgccgaggcgatgggcgccgaggatcccctgttcatcctc
tacacctcgggctcgacgggccgtcccaagggcgtgctgcacaccaccggcggctatctc
gcctgggctgcctggacccacgaggcggtcttcgactaccgcccgggccaggtctactgg
tgcaccgcggacgtgggctgggtgaccggccacagctacatcgtctacggccccctcgcg
aacggggccacgaccctgatgttcgagggcgtgccgaactatccctcgctcagccgctgc
tggcaggtgatcgacaagcaccaggtcgagatcttctacaccgccccgaccgccatccgc
gccctgatgcgcgagggcgaggcgccggtggcccgcacgtcccgcaggtcgctgcgcctg
ctgggctcggtgggcgagccgatcaaccccgaggcctggctctggtaccatcgcgtggtg
ggcgagcaccgctgcccgatcgtcgacacctggtggcagaccgagaccggcggaatcctg
atctcgcccctgcccggcgccacgacgctgaagcccggctcggccacccggccgctgccc
ggcgtgaagctggccctggtggacgccgacggacggccgctcgagggcgcgggcgagggc
aacctgtgcctgaccgacagctggccaggccagatgcgcacggtctggaacgaccacgag
cgcttcctgcagacctatttctccacctatccggggaagtacttcaccggcgacggctgc
cgccgcgacgccgacggggactactggatcaccggccgggtggacgacgtgctgaacgtc
tcgggccaccggctgggcacggccgaggtggagagcgccctcgtcgcccatccgaaggtg
gccgaggccgcggtggtcggcttcccgcacgaggtgaagggtcaggggatctactgctac
gtcaccctcaaggccggcgagcagcccggcccggcgctggagaaggcgctggtggactgg
gtgcggcgcgagatcggtcccatcgccacgcccgacgtgatccagtgggcccccggcctg
cccaagacccgctcgggcaagatcatgcgccgcatcctgcgcaagatcgccgagggcgac
accgccaacctcggcgacacctcgaccctggccgatccgggggtggtggacgacctcgtc
gcacgcaagcgcctcgagcccgcctga

DBGET integrated database retrieval system