KEGG   Phenylobacterium zucineum: PHZ_c2912Help
Entry
PHZ_c2912         CDS       T00750                                 

Definition
D-cysteine desulfhydrase
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
pzu  Phenylobacterium zucineum
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PHZ_c2912
Enzymes [BR:pzu01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.25  L-cysteate sulfo-lyase
     PHZ_c2912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3327385..3328404
Genome map
AA seq 339 aa AA seqDB search
MHLARYNPVRFAHLPTPLEPLPGLTEALVMPGGGGPTLWIKRDDCTGLAGGGNKTRKLEY
LLGDALANDADTLVTQGAVQSNHVRQTAAAAARFGLRCEVILEHRTGSKALDYNLSGNVL
LDELLGAKIRHVPAGTDMNGALADVAQEIADAGGRPYVIPGGGSNCIGALGYAECALELV
AQANELGLEIDRIVTATGSAGTHAGLVAGLAVMGADIPVLGIGVRAPKEQQEASVYKLAR
ETAALLGHEDRVTREMVEADCDYVGEGYGLVDEGVIDALKMAARADAILLDPVYTGKAMK
GLIALSRSGAFDGETVVFLHTGGAQGLFGYQSELEGKLG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcacctggcccgatacaaccccgtccgcttcgcccacctgcccacgccgctggagccc
ctgcccggcctgaccgaggcgctggtcatgcccggcggcggcgggccgacgctgtggatc
aagcgcgacgactgcaccggcctggccggcggcggcaacaagacccgcaagctcgagtac
ctgctgggcgacgccctggccaacgacgccgacaccctggtcacgcaaggggcggtgcag
tcgaaccacgtgcgccagacggcggcggccgcggcccgtttcggcctgaggtgcgaggtg
atcctcgagcaccgcacgggctccaaggcgctggactacaacctgtcgggcaacgtgctg
ctggacgagctgctgggcgcgaagatccggcacgtgccggccgggaccgacatgaacggg
gccttggcggacgtcgcccaggaaatcgccgacgccggcgggcggccctatgtgatcccc
ggcggcggctcgaactgcatcggcgcgctgggctacgccgagtgcgccctggagctggtg
gcccaggccaacgagcttggcctggagatcgaccgcatcgtcaccgccaccggcagcgcg
ggcacccacgccggcctcgtggcggggctggccgtgatgggcgcggacatccccgtgctg
ggcatcggcgtgcgcgcgccgaaggagcagcaggaggccagcgtctacaagctggcccgc
gagaccgccgcgctgctgggccacgaggaccgtgtgacccgcgagatggtcgaggccgac
tgcgactacgtcggcgaaggctacggcctggtcgacgagggcgtgatcgacgcgctgaag
atggccgcgcgcgccgacgccatcctgctggacccggtctatacggggaaggcgatgaag
ggcctgatcgccctctcccgctcgggcgcgttcgacggcgagacggtggtgttcctgcac
accggcggcgcgcagggcctgttcggctaccagtccgaactggaaggcaagctcggatga

DBGET integrated database retrieval system