KEGG   Phenylobacterium zucineum: PHZ_c2957Help
Entry
PHZ_c2957         CDS       T00750                                 

Gene name
gpm
Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pzu  Phenylobacterium zucineum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHZ_c2957 (gpm)
   01230 Biosynthesis of amino acids
    PHZ_c2957 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHZ_c2957 (gpm)
  Energy metabolism
   00680 Methane metabolism
    PHZ_c2957 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PHZ_c2957 (gpm)
Enzymes [BR:pzu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PHZ_c2957 (gpm)
Exosome [BR:pzu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PHZ_c2957 (gpm)
  Exosomal proteins of melanoma cells
   PHZ_c2957 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3377357..3378067)
Genome map
AA seq 236 aa AA seqDB search
MPTLILLRHGQSQWNLENRFTGWVDVDLTAQGEAEAAKGGELIGQAGLAIDRCFTSVLTR
AIRTSWLALAAAGQTFVPEVKDWRLNERHYGGLTGLNKAETAEKHGEEQVKIWRRSYDIP
PPPLAAGSEYDFSKDRRYAGADLPDTESLKTTLERVQPYWESDIVPCLQAGETLLVAAHG
NSLRAIVKLLFDVGDEAIVGVEIPTGNPLVVELDADLKPTAARYLDADRAQALPQV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
ttgcccaccctgatcctgctgcgtcacggccagagccagtggaacctcgagaaccgcttc
accggctgggtggatgtcgacctgaccgcccagggcgaggccgaggccgccaagggcggc
gagctgatcgggcaggcgggcctggcgatcgaccgctgcttcacctcggtgctgacgcgg
gcgatccgcacctcgtggctggccctggccgccgcgggccagaccttcgtgcccgaggtg
aaggactggcggctgaacgagcgccactacggcggcctgaccggcctcaacaaggccgag
accgccgagaagcacggcgaagagcaggtcaagatctggcgccgctcgtacgacatcccg
ccgccgccgctggccgccggctcggagtacgacttctcgaaggaccgccgctacgccggc
gccgacctgccggacaccgagagcctgaagaccaccctggagcgcgtgcagccctactgg
gagagcgacatcgtcccctgcctgcaggcgggcgagaccctgctggtggcggcgcacggc
aattcgctgcgggcgatcgtcaagctgctgttcgacgtgggcgacgaggccatcgtcggc
gtcgagatccctacgggcaatccgctggtggtcgagctggatgcggacctgaagccgacg
gcggccagatacctcgacgcggaccgtgcgcaggcgctgccgcaggtctag

DBGET integrated database retrieval system