KEGG   Phenylobacterium zucineum: PHZ_c2960Help
Entry
PHZ_c2960         CDS       T00750                                 

Definition
phosphoglucomutase/phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pzu  Phenylobacterium zucineum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHZ_c2960
   00030 Pentose phosphate pathway
    PHZ_c2960
   00051 Fructose and mannose metabolism
    PHZ_c2960
   00052 Galactose metabolism
    PHZ_c2960
   00500 Starch and sucrose metabolism
    PHZ_c2960
   00520 Amino sugar and nucleotide sugar metabolism
    PHZ_c2960
  Nucleotide metabolism
   00230 Purine metabolism
    PHZ_c2960
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PHZ_c2960
Enzymes [BR:pzu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PHZ_c2960
    5.4.2.8  phosphomannomutase
     PHZ_c2960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3379821..3381323
Genome map
AA seq 500 aa AA seqDB search
MLSAPRADLKPNTFDYENLPLVKATGFREYDARWLFGPEINLLGVQALGLGLGTYIHELG
QKRIVVAHDFRSYSLSIKQALTIGLVAAGCEVIDIGLAVSPMAYFAQFDLDAPCVAMVTA
SHNENGWTGVKMGAQRPLTFGPDEMGRLKEIVLKGEWKQRPGGSVAHVAGVAERYIADVA
SRASLTRPLKVVAACGNGTAGAFAPEALRRMGVAVVVEMDCELDYTFPKYNPNPEDSVML
HAMAKAVREYDADVALGFDGDGDRCGVVDDEGEEIFADKIGLMLARDLSALHKDATFVVD
VKSTGLFATDEVLKANGASTVYWKTGHSYIKRKTAELGALAGFEKSGHFFFNPPIGRGYD
DGLVAAAAILSMLDRNPGKKLSDLKKALPVAFTSLTMSPHCADEEKYGVVEDVVREYTEF
ANGGGTILGRKITDLVTVNGVRVALEDGSWVLVRASSNKPELVVVVESTQSEDDMRRLFR
EEVKPRLARRSQVGAYNQEI
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccgcacctcgcgccgacctgaagccgaacaccttcgactacgagaacctgccg
ctggtgaaggccaccggctttcgggaatacgacgcgcgctggctgttcggacccgagatc
aacctgctgggcgtccaggcgctgggcctggggctggggacctacatccacgagctgggc
cagaagcggatcgtggtcgcccacgacttccggtcctattcgctgtcgatcaagcaggcg
ctgaccatcggcctggtcgccgccgggtgcgaggtgatcgacatcggcctggccgtctcg
ccgatggcctatttcgcccagttcgacctggacgccccgtgcgtggccatggtcaccgcc
agccacaacgagaacggctggaccggcgtgaagatgggcgcccagcgcccgctgaccttc
gggccggacgagatgggccggctgaaggagatcgtcctgaagggcgagtggaagcagcgg
cccggcggctcggtggcccacgtcgccggcgtggccgagcgctacatcgccgacgtcgcc
tcgcgcgccagtctgacgcggccgctgaaggtggtggccgcctgcggcaacggcaccgcc
ggcgccttcgcccccgaggccctgcgccggatgggcgtggccgtggtcgtcgagatggat
tgcgagctcgactataccttcccgaagtacaacccgaaccccgaggacagcgtcatgctg
cacgccatggccaaggccgtgcgcgagtacgacgccgacgtggcgctgggcttcgacggc
gacggcgaccgctgcggggtggtggacgacgagggcgaggagatcttcgccgacaagatc
ggcctgatgctggcccgggacctgtcggccctgcacaaagacgcgacgttcgtggtggac
gtgaagtccacgggcctgttcgccaccgacgaggtgctgaaggcgaacggcgccagcacg
gtctactggaagaccggccacagctacatcaagcgcaagaccgccgagctgggcgccctc
gccggcttcgagaagagcggccacttcttcttcaacccgccgatcggccgcggctacgac
gacggcctggtcgcggcggccgccatcctgtcgatgctggaccgcaaccccggcaagaag
ctgtccgacctgaagaaggccctgccggtcgccttcacctcgttgaccatgagcccgcat
tgcgccgacgaggagaagtacggcgtcgtcgaggacgtggtccgcgagtacaccgagttc
gccaatggcggcgggaccattctggggcggaagatcaccgacctcgtcaccgtcaacggc
gtgcgcgtcgcgctggaggacggctcgtgggtgctggtgcgcgcctcgtccaacaagccc
gagctggtggtggtggtcgagagcacccagtccgaggacgacatgcgccggctgttccgc
gaggaggtgaagcccaggctcgccaggcgctcccaggtcggcgcctacaaccaggaaatc
tga

DBGET integrated database retrieval system