KEGG   Phenylobacterium zucineum: PHZ_c2965Help
Entry
PHZ_c2965         CDS       T00750                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pzu  Phenylobacterium zucineum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PHZ_c2965 (galU)
   00052 Galactose metabolism
    PHZ_c2965 (galU)
   00500 Starch and sucrose metabolism
    PHZ_c2965 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PHZ_c2965 (galU)
Enzymes [BR:pzu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PHZ_c2965 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3386893..3387762
Genome map
AA seq 289 aa AA seqDB search
MTKRVRKAVLPVAGLGTRVLPGAKTTPKNLLNVVDRPILSYIVEEARAAGIEHIVFIVGR
GQGAIEDYFDASPEIEQALEAKGKTDILAEVRRDLPQPGQMSFVRQMAPLGLGHAVWCAR
DVIGDEPFAVMLPDMLMAAEPGALAQAVAAYERVGGNIVVVEPAPEGEAHKYGIVALQGQ
DGRLNRMTGMVEKPKPGTEPSNLFISGRYILQPEIFEILETQERGAGGEIQLTDGMANLM
KVQDFHALEYEGTTYDCGDKIGLLRANVAFALMRPELKDAARKAIEALL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagcgcgtgcgcaaggccgtcctgcccgtggcgggactgggaacccgggtgctg
cccggagcgaagaccactcccaagaacctgctgaacgtcgtggaccggccgatcctgtcc
tacatcgtcgaggaggcgcgggcggccggcatcgagcacatcgtcttcatcgtcggccgc
ggccagggcgccatcgaggactatttcgacgccagtcccgagatcgagcaggcgctggag
gccaagggcaagaccgacatcctggccgaggtgcgccgcgacctgccccagcccggccag
atgagcttcgtgcgccagatggcgcccctgggcctggggcacgccgtctggtgcgccagg
gacgtgatcggcgacgagcccttcgccgtcatgctgcccgacatgctgatggccgccgag
cccggcgcgctggcgcaggcggtggcggcctacgagagggtcggcggcaacatcgtggtg
gtcgagcccgcccccgagggcgaggcgcacaagtacgggatcgtcgccctgcagggccag
gacggccggctgaaccggatgaccggcatggtcgagaagccgaagccggggaccgagccc
tcgaacctgttcatctcgggccgctacatcctgcagcccgagatcttcgagatcctggag
acccaggagcgcggcgcgggcggcgagatccaactcaccgacggcatggcgaacctgatg
aaggtccaggacttccacgccctggagtacgaggggaccacctacgactgcggcgacaag
atcggcctgctgcgcgccaacgtggccttcgccctgatgcgtcccgagctgaaggacgcc
gcccgcaaggcgatcgaggcgctgctctga

DBGET integrated database retrieval system