KEGG   Phenylobacterium zucineum: PHZ_c3118Help
Entry
PHZ_c3118         CDS       T00750                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pzu  Phenylobacterium zucineum
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pzu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3544986..3545579
Genome map
AA seq 197 aa AA seqDB search
MSMSDEKRRPSEAEALAAVRTLIEWAGDDPDREGLLDTPRRVVKSYKELFAGYETDPREY
LQRTFDEVGGYDELVILKDIRVVSFCEHHMLPFLGKAHVGYLPRNRVVGISKLARVVHGF
ARRLQIQEKLTAEIAEAIQDILQPKGVGVVIVSEHSCMTMRGVNTPGSRLTTSHLLGEVR
DDPRTRTEFFELVRNGA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttgagcatgtccgacgagaagcgacgccccagcgaggccgaggccctcgccgccgtgcgg
accctcatcgagtgggccggggacgatccggaccgcgagggcctgctcgacaccccccgc
cgggtggtgaagtcgtacaaggagctgttcgccggctacgagaccgatccgcgcgagtac
ctccagcgcaccttcgacgaggtcggcggctacgacgagctggtgatcctcaaggacatc
cgggtggtcagcttctgcgagcaccacatgctgccgttcctcggcaaggcgcacgtcggc
tacctgccgcgcaaccgggtggtcggcatctcgaagctggcgcgggtggtccacggcttc
gcccggcggttgcagatccaggagaagctgaccgccgagatcgccgaggccatccaggac
atcctgcagccgaagggcgtgggcgtggtgatcgtatccgagcacagctgcatgaccatg
cggggcgtgaacacgccgggctcgcgcctgaccaccagccacctgctgggcgaggttcgg
gacgatccgcgcacccggaccgagttcttcgagctggtccggaacggcgcctag

DBGET integrated database retrieval system