KEGG   Phenylobacterium zucineum: PHZ_c3210Help
Entry
PHZ_c3210         CDS       T00750                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pzu  Phenylobacterium zucineum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHZ_c3210 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PHZ_c3210 (aceA)
Enzymes [BR:pzu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PHZ_c3210 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3640237..3641844
Genome map
AA seq 535 aa AA seqDB search
MWKRQMAYQDHIIEMSQLVQAKNGAWDGIDPEAVARMRLQNRFKTGLEIAKYTADIMRKD
MAAYDADPSQYTQSLGCWHGFVAQQKMIGIKRHFGTTKRRYIYLSGWMIAALRSEFGPLP
DQSMHEKTSVPALIEEIYTFLKQADARELGGLFRDLDAARKAGDAAKEQQIQDKIDNFET
HVVPIIADIDAGFGNAEATYLLAKKMIEAGACAIQIENQVSDEKQCGHQDGKVTVPHEDF
IQKLRAVRYAFLELGVDNGVIVARTDSLGAGLTKQIAFSKEPGDLGDQYNSFLDCEEIDP
AQVGNGDVVITRNGKLLRPKRLPSNLFQFREGTGVDRVVLDCVTSLKNGADLLWIETEKP
HVEQIASMVDRIREVVPNAKLAYNNSPSFNWTLKFREQVFEEWTKEGKDVSAYDKSKLMS
AEYDETPLGIEADQKIRSFQADSAKRAGIFHHLITLPTYHTAALSTDNLAKEYFGDQGML
GYVLGVQRQEIRKGLPCVKHQNMSGSDIGDDHKEYFAGEAALKAGGVHNTMNQFA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
ttgtggaagaggcagatggcgtatcaggaccacatcatcgagatgagccagctcgttcag
gcgaagaacggcgcgtgggacgggatcgatcccgaggccgtggcgcggatgcgcctgcag
aaccggttcaagaccggcctggagatcgccaagtacaccgccgacatcatgcgcaaggac
atggcggcctatgacgccgacccctcgcagtacacccagagcctcggctgctggcacggc
ttcgtcgcccagcagaagatgatcggcatcaagcgccacttcggcacgaccaagcgccgc
tacatctacctgtcgggctggatgatcgccgcgctgcgctcggagttcggcccgctgccc
gaccagtcgatgcacgagaagacctcggtcccggcgctgatcgaagagatctacaccttc
ctgaagcaggccgacgcccgcgagctgggcggcctgttccgcgacctcgacgccgcccgc
aaggccggcgacgcagccaaggaacagcagatccaggacaagatcgacaacttcgagacg
cacgtcgttccgatcatcgccgacatcgacgccggcttcggcaacgccgaggcgacctac
ctgctggccaagaagatgatcgaagccggcgcctgcgccatccagatcgagaaccaggtc
tcggacgagaagcagtgcggccaccaggacggcaaggtcaccgtcccccacgaggacttc
atccagaagctgcgggccgtccgctacgccttcctggagctgggcgtcgacaacggcgtc
atcgtcgcgcgcaccgacagcctgggcgccggcctgaccaagcagatcgccttctcgaag
gagccgggcgacctgggcgaccagtacaatagcttcctcgactgcgaggagatcgatccg
gcccaagtcggcaacggcgacgtggtgatcacccggaacggcaagctgctgcgtccgaag
cgcctgccctccaacctgttccagttccgcgaaggcaccggcgtcgaccgggtcgtgctg
gactgcgtcacctcgctcaagaacggcgccgacctgctgtggatcgagaccgagaagccg
cacgtcgagcagatcgccagcatggtcgaccgcattcgcgaggtcgtcccgaacgccaag
ctcgcctacaacaacagcccgtccttcaactggaccctgaagttccgcgagcaggtcttc
gaggagtggaccaaggaaggcaaggacgtgtcggcctacgacaagtccaagctgatgagc
gccgagtacgacgagaccccgctggggatcgaagcggaccagaagatccgcagcttccag
gcggactcggccaagcgcgccggcatcttccaccacctgatcacgctgccgacctaccac
acggccgcgctcagcaccgacaacctggccaaggagtacttcggcgaccagggcatgctg
ggctacgtcctgggcgtccagcggcaggagatccgcaagggcctgccctgcgtgaagcac
cagaacatgtcgggctcggacatcggcgacgaccacaaggagtacttcgcgggcgaagcg
gccctgaaggccggcggcgtccacaacacgatgaaccagttcgcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system