KEGG   Phenylobacterium zucineum: PHZ_c3212Help
Entry
PHZ_c3212         CDS       T00750                                 

Gene name
aceB
Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pzu  Phenylobacterium zucineum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHZ_c3212 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PHZ_c3212 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    PHZ_c3212 (aceB)
Enzymes [BR:pzu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PHZ_c3212 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3642206..3643807
Genome map
AA seq 533 aa AA seqDB search
MSVDLATRPAVKLTQPFEGRDSEVLTPEALAFLGQLHARFNDRRLELLALREERQTRFDA
GAKPDFLAETKAIRDGDWKVAPIPADLQDRRVEITGPVDRKMIINALNSGARVFMADFED
ASAPTWRNMVDGQINLMDRWGGRIGFTDPNTGKSYALKDKVATLIVRPRGWHLPEAHALV
DGEEMSGGLFDFGLYFFHCAKTSLAAGSGPYFYLPKMESHLEARLWNEVFVYAQDALGVP
QGTIKATVLIETLPAAFEMDEIIYELRDHMAGLNCGRWDYIFSFIKRLKAHPDALTPDRA
VMTMGKAFLQAYSYKLIQTCHRRGAFAMGGMAAQIPVKGDPAANEAAFAKVRADKEREAT
NGHDGTWVAHPDLVPVAMEVFDRLMPTPNQLGKLREDITVTREDMLQVHDGERTEAGLRE
NIRVGVQYIEAWLRGRGAVPLYNLMEDAATAEISRTQIWQWIHHKAKLADGREVTPELFR
QVLDEEMAGLRQTLPGGSFETGRFAEAQKIFVEMCLAETLEEFLTLPAYRVLD
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcgacctcgccacgcggcctgccgtgaagctgacccaaccgttcgagggccgc
gattccgaggtgctgacgcccgaggccctggccttcctcggccagctgcacgcccgcttc
aacgaccgccgcctcgagctgctggccctgcgcgaggagcgccagacccgcttcgacgcc
ggcgccaagcccgacttcctggccgagaccaaggcgatccgcgacggcgactggaaggtc
gccccaatccccgccgacctgcaggaccgccgggtcgagatcaccggccccgtcgaccgc
aagatgatcatcaacgccctgaactcgggcgcgcgggtgttcatggccgacttcgaggac
gccagcgcccccacctggcgcaacatggtcgacggccagatcaacctgatggaccgctgg
gggggcaggatcggcttcaccgatcccaacaccggcaagagctatgcgctgaaggacaag
gtcgcgaccctgatcgtccgcccgcgcggctggcacctgccggaggcccacgccctcgtc
gacggcgaggagatgagcggcgggctattcgatttcggcctctacttcttccactgcgcc
aagacctcgctggccgcgggctcgggtccctacttctacctgcccaagatggagagccac
ctcgaggcgcggctgtggaacgaggtgttcgtctacgcccaggacgcgctgggcgtgccg
cagggcacgatcaaggccaccgtgctgatcgagaccctgcccgccgccttcgagatggac
gagatcatctacgagctgcgcgaccacatggcgggcctcaactgtggccgctgggactac
atcttctcgttcatcaagcgcctgaaggcccatcccgacgcgctgacgcccgaccgggcg
gtgatgaccatgggcaaggccttcctgcaggcctactcgtacaagctgatccagacctgc
caccgccggggcgccttcgccatgggcgggatggccgcccagatccccgtgaagggcgat
ccggccgccaacgaggccgccttcgccaaggtccgcgccgacaaggagcgcgaggcgacc
aacggccacgacggcacctgggtggcccaccccgacctggtgcccgtcgccatggaggtg
ttcgaccggctgatgccgaccccgaaccagctcggcaagctgcgcgaggacatcaccgtc
acccgcgaggacatgctgcaggtccacgacggcgagcggaccgaggcaggcctgcgcgag
aacatccgcgtgggcgtgcagtacatcgaggcctggctgcgcggccgcggcgcggtgccg
ctctacaacctcatggaggacgcggcgacggccgagatcagccgcacccagatctggcag
tggatccaccacaaagccaagctggccgacggccgcgaggtgacccccgagctgttccgc
caggtgctggacgaggagatggcgggcctgcgccagaccctgccgggcgggtcgttcgag
actggccgcttcgccgaggcccagaaaatcttcgtcgagatgtgcctcgccgagaccctc
gaggaattcctcacgctgccggcgtaccgggtgctggattga

DBGET integrated database retrieval system