KEGG   Phenylobacterium zucineum: PHZ_c3238Help
Entry
PHZ_c3238         CDS       T00750                                 

Gene name
cheB
Definition
chemotaxis response regulator (protein-glutamate methylesterase)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pzu  Phenylobacterium zucineum
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pzu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pzu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3670163..3671242)
Genome map
AA seq 359 aa AA seqDB search
MSAGANAVASDVRARVMVVDDSAVVRGLITRQLESDSRLEVVCTASNGELALRELARHPV
DVVVLDIEMPVMDGLTALQRIVAEHPGVRVIMASTLTLRNAEISLKALQLGASDYVAKPE
NGLAGAQEFQRELTSKILALAPRRARPAPAPASPAARRPIVPALRRTLPQVLAIGASTGG
PPALLQVFEALKGAVRLPILLTQHMPATFTALLAEQIGRAGDRPCAEARDGEPVVPGRCY
VAPGGWHMTVEREGAGVFIRLNQEPPENFCRPAVDPMLRSVAQAYGPAALAVILTGMGSD
GAKGCEAIAAAGGRFIVQDEATSVVWGMPGAAAATGRAEGVLPLSEVGGWIRRATEVAA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagcaggtgcgaacgccgtggcttccgacgtccgggcgcgcgtcatggttgtcgac
gactcggccgtggtgcgcggcctgatcacccggcagctcgaatcggattctcggctggag
gtggtctgcaccgcctccaacggcgaactggcgctgcgcgagctggcgcgccacccggtc
gacgtggtggtgctcgacatcgagatgccggtgatggacggcctcaccgcgctccagcgc
atcgtcgccgagcacccgggcgtgcgcgtgatcatggcgtccaccctcaccctccggaac
gcggagatcagcctgaaggccctgcagctcggggcctcggactatgtggccaagcccgag
aacggcctcgccggcgcgcaggagttccagcgcgagctgacctccaagatcctggcgctc
gccccccgccgagcccggcccgcgcccgcgccggcctcgcccgccgcccgccgtccgatc
gtcccggccctgcggcggaccctgcctcaggtcctcgccatcggcgcttcgacgggcggg
ccgccggccctgctgcaggtcttcgaggcgctgaagggcgccgtgcgcctgcccatactg
ctgacccagcacatgcccgcgaccttcaccgccctgctggccgaacagattggccgggcg
ggagaccggccctgcgccgaggcccgcgacggcgagccggtcgtccccggccggtgctac
gtcgccccgggcggctggcacatgaccgtcgagcgcgagggcgccggcgtgttcatccgc
ctgaaccaggagccgcccgagaacttctgccgcccggcggtcgatccgatgctgcgcagc
gtcgcccaggcctacggacccgccgcgctcgcggtgatcctgacaggtatgggctcggac
ggcgccaagggctgcgaggccatcgccgccgccggcggccggttcatcgtccaggacgag
gcgaccagcgtggtctggggcatgcccggcgcggccgccgccaccggacgggccgagggg
gtcttgcccctgtccgaggtggggggctggatccgccgtgcgaccgaggtggcggcatga

DBGET integrated database retrieval system