KEGG   Phenylobacterium zucineum: PHZ_c3251Help
Entry
PHZ_c3251         CDS       T00750                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pzu  Phenylobacterium zucineum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHZ_c3251 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHZ_c3251 (glk)
   00052 Galactose metabolism
    PHZ_c3251 (glk)
   00500 Starch and sucrose metabolism
    PHZ_c3251 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PHZ_c3251 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PHZ_c3251 (glk)
   00524 Butirosin and neomycin biosynthesis
    PHZ_c3251 (glk)
Enzymes [BR:pzu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PHZ_c3251 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3684064..3685035)
Genome map
AA seq 323 aa AA seqDB search
MKPQYAGLVGDVGGTHARFALVDVEGRIRNPRTFESREYGSLTDIVAEYIQTTAGKRRPP
RAVIAVAGPVLDGEIEFTNLDWHVTEGDLLAHFEFEAVKLINDFAAQALACPRLDAGDLR
AIGPDLGRGAYDCPVVVLGAGTGFGVAGVARSERGDVAVATEGGHAAFAPTDEIEVELWR
RLKARYGRVSIERLLSGQGLFDIYQGLADIEGRPAPLADPPAVMTEGLAGDPLAGAALDR
FAGILGSVAGDLALSFGARGGVYVSGGIAPRMADRLAAGPFRARFEDKGRLSDYVRGVPT
YLVLHPYPAIVGAARELEQMERL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgcagtacgcaggcctggtgggcgacgtcggcggcacccacgcccgcttcgcc
ctggtggacgtcgaagggcgcatccgcaacccgcgcaccttcgagtcgcgcgagtacggc
agcctcaccgacatcgtcgccgagtacatccagaccactgcggggaagcggcggccgccc
cgggcggtgatcgcggtggccgggccggtgctcgacggcgagatcgagttcaccaacctc
gactggcacgtcaccgagggcgacctcctggcccacttcgagttcgaggcggtcaagctg
atcaacgacttcgcggcccaggcgctggcgtgcccgcggctggacgcgggcgacctgcgg
gccatcggtcccgacctcggccgcggcgcctacgactgtccggtggtggtcctgggcgcg
ggcacgggcttcggcgtggcgggcgtggcgcgcagcgagcgcggcgacgtggccgtggcg
accgagggcggccacgccgccttcgcccccaccgacgagatcgaggtcgagctctggcgc
cggctgaaggcgcgctacggccgggtctcgatcgagcggctgctgtcggggcaggggctg
ttcgacatctaccaggggctggcggacatcgagggccgtcccgcgccgctcgccgacccg
ccggcggtgatgaccgaggggctggcgggcgatcccctggccggcgcggcgctggaccgg
ttcgccggcatcctgggctcggtggccggcgacctcgcgctcagcttcggggcccgcggc
ggggtctatgtctcgggcggcatcgccccgcgcatggccgaccggctggccgccggcccc
ttccgcgcccgcttcgaggacaagggccgcctctcggactatgttcgcggcgtcccgacc
tatctcgtgctgcatccctatccggccatcgtcggcgccgcgcgcgaacttgagcagatg
gagcgtctatga

DBGET integrated database retrieval system