KEGG   Phenylobacterium zucineum: PHZ_c3328Help
Entry
PHZ_c3328         CDS       T00750                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu00071  Fatty acid degradation
pzu00280  Valine, leucine and isoleucine degradation
pzu00281  Geraniol degradation
pzu00310  Lysine degradation
pzu00360  Phenylalanine metabolism
pzu00362  Benzoate degradation
pzu00380  Tryptophan metabolism
pzu00410  beta-Alanine metabolism
pzu00627  Aminobenzoate degradation
pzu00640  Propanoate metabolism
pzu00650  Butanoate metabolism
pzu00903  Limonene and pinene degradation
pzu00930  Caprolactam degradation
pzu01100  Metabolic pathways
pzu01110  Biosynthesis of secondary metabolites
pzu01120  Microbial metabolism in diverse environments
pzu01130  Biosynthesis of antibiotics
pzu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PHZ_c3328
   00650 Butanoate metabolism
    PHZ_c3328
  Lipid metabolism
   00071 Fatty acid degradation
    PHZ_c3328
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PHZ_c3328
   00310 Lysine degradation
    PHZ_c3328
   00360 Phenylalanine metabolism
    PHZ_c3328
   00380 Tryptophan metabolism
    PHZ_c3328
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PHZ_c3328
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PHZ_c3328
   00281 Geraniol degradation
    PHZ_c3328
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PHZ_c3328
   00627 Aminobenzoate degradation
    PHZ_c3328
   00930 Caprolactam degradation
    PHZ_c3328
Enzymes [BR:pzu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PHZ_c3328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACG79737
UniProt: B4RB92
Position
3770340..3771191
Genome map
AA seq 283 aa AA seqDB search
MTTTEWTCFDVTIEDKVAHIRLKRPEALNTMVRAFWNELPQIVRDISDNARARCIVISST
GKHFCAGMDLAVFQGGGSTSAPASQDKHVNAEAMRYHVRLLQDSFSCLDQARIPVIAAIQ
GGCIGGAVDMTSACDIRYCTADAFFVIQEINIGMTADVGTFPRLCKLIPEGWVRELAYTG
RRLPAQKAREIGLVNEVFDTHEQLLEHALGTAREIASKAPLAVTGSKVMINYARDHSIAD
ALDYIAVWQTGMFSGPHMAEAFKAKAEKREADFPDLAPLRKEM
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccaccgagtggacctgcttcgacgtcacgatcgaggacaaggtcgcccatatc
cggctgaagcggcccgaggcgctgaacaccatggtgcgggcgttctggaacgagctgccg
cagatcgtgcgcgacatcagcgacaacgcgcgggcccgctgcatcgtgatctcgtccacc
ggcaagcacttctgcgccggcatggacctggcggtgttccagggcggcggctcgacctcg
gctccggcgtcgcaggacaagcacgtcaacgccgaggccatgcgctaccacgtccgcctg
ctgcaggactccttctcctgcctcgaccaggcccgcatcccggtgatcgcggcgatccag
ggcgggtgcatcggcggggcggtcgacatgaccagcgcctgcgacatccgctactgcacc
gccgacgccttcttcgtgatccaggagatcaacatcggcatgaccgccgacgtcgggacc
ttcccgcggctgtgcaagctgatccccgagggctgggtgcgcgagctggcctacaccggc
cgcaggctgccggcccagaaggcgcgcgagatcggcctcgtcaacgaggtgttcgacacc
cacgagcaactgctggagcacgcgctcggcacggcccgggagatcgcgtccaaggcgccg
ctggcggtgaccggctcgaaggtgatgatcaactacgcccgcgaccactccatcgccgac
gccctcgactacatcgcggtctggcagacggggatgttctcggggccgcacatggccgag
gcgttcaaggccaaggccgagaagcgcgaggccgacttcccggacctcgccccgctccgc
aaggagatgtga

DBGET integrated database retrieval system