KEGG   Phenylobacterium zucineum: PHZ_c3413Help
Entry
PHZ_c3413         CDS       T00750                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu00010  Glycolysis / Gluconeogenesis
pzu00620  Pyruvate metabolism
pzu00640  Propanoate metabolism
pzu00680  Methane metabolism
pzu01100  Metabolic pathways
pzu01110  Biosynthesis of secondary metabolites
pzu01120  Microbial metabolism in diverse environments
pzu01130  Biosynthesis of antibiotics
pzu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHZ_c3413 (acs)
   00620 Pyruvate metabolism
    PHZ_c3413 (acs)
   00640 Propanoate metabolism
    PHZ_c3413 (acs)
  Energy metabolism
   00680 Methane metabolism
    PHZ_c3413 (acs)
Enzymes [BR:pzu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PHZ_c3413 (acs)
Lipid biosynthesis proteins [BR:pzu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PHZ_c3413 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACG79822
UniProt: B4RC29
Position
3860607..3862937
Genome map
AA seq 776 aa AA seqDB search
MSDGEVFPVPEEWAKRAHMDAAAYEAACRRADEDPEGFWREVGERLDWITPFTQVKDVSF
NREDFRIRWYADGALNVSVNCLDRHIETRGDQVAIIWESDDGQVSDKLTYRQLLAETCRW
ANVLKAKGVKKGDRVTIYLPMIPAAAAAMLACARIGAVHSVVFGGFSPDSLAGRIQDCDS
RIVITANEGLRGGKVVPLKANVDEALKTCPGVTDVIVVRRTQTEVPMTPGRDEYYGDLKK
TVPDTCDPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYLAWAAYTHELVFDYRPGEVFW
CTADVGWVTGHSYVVYGPLANAATSLIFEGVPNYPTSSRFWEVCDKHKVEIFYTAPTAIR
ALMREGEEPVRRTSRSTIRLLGTVGEPINPEAWLWYHRVVGEGRCPIVDTWWQTETGACL
MSPLPGATPLKPGSCTRPLPGVKPQLVDAEGKVLDGATSGNLCLTDSWPGQMRTVYGDHE
RFIVTYFTTYPGKYFTGDGARRDEDGYYWITGRVDDVINVSGHRLGTAEIESALVGHEAV
AEAAVVGYPHEIKGQGIYCYVTLKVGEHPSEALQADLRGWVRREIGPFAAPDVIQFAPGL
PKTRSGKIMRRILRKIAEDDLGNLGDTSTLADPAVVDDLVAHRAGASAGDVVELAGRKLP
AAELEQLIVENTPVADAVVVSPRGKGLWCFVALEPGFQPSDILKADIRAVLKRQVGEHAV
PEFVYVGRDLPRSAGGEVVRPLLHRIAEGEPVGDTKGLSNPAVLDDLLKARAEAVA
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacggcgaggttttcccggttcctgaggaatgggccaagcgggcccacatggac
gccgcggcctacgaggcggcgtgccgacgggccgacgaggaccccgaaggcttctggcgc
gaggtcggcgagcggctcgactggatcacccccttcactcaggtgaaggacgtctcgttc
aaccgcgaggacttccgcatccgctggtacgcggacggggcgctgaacgtctcggtcaac
tgcctggaccggcacatcgagacccgcggcgatcaggtggcgatcatctgggagagcgac
gacggccaggtgtcggacaagctcacctaccgccagctcctcgcggagacctgccggtgg
gcgaacgtgcttaaggccaagggcgtcaagaaaggcgaccgggtcaccatctacctgccg
atgatcccggcggccgcggcggcgatgctggcctgcgcccggatcggggcggtgcactcg
gtggtgttcggcggcttctcgcccgacagcctggccggccggatccaggactgcgactcc
aggatcgtcatcaccgccaacgagggcctgcgcggcggcaaggtcgtgccgctgaaggcc
aacgtcgacgaggcgctgaagacctgcccgggcgtgaccgacgtcatcgtggttcgccgg
acccagaccgaggtcccgatgaccccgggccgcgacgaatactacggcgacctgaagaag
accgtccccgacacctgcgaccccgagccgatgaacgccgaggatccgctgttcatcctc
tacacctcgggctcgacggggaagcccaagggcgtgctgcacaccaccggcggctatctc
gcctgggcggcctacacccatgagctggtgttcgactaccggcccggcgaggtgttctgg
tgcaccgccgacgtgggctgggtgaccggccacagctacgtcgtctacggcccgctggcc
aacgcggccaccagcctgatcttcgagggcgtgcccaactatccgacctcgtcgcgcttc
tgggaggtctgcgacaagcacaaggtcgagatcttctacaccgccccgacggcgatccgc
gcgctgatgcgcgagggcgaagagccggtccggcggaccagccgctccacgatccgcctg
ttgggcaccgtgggcgagccgatcaatcccgaggcctggctctggtaccaccgcgtggtc
ggcgagggccgctgcccgatcgtcgacacctggtggcagaccgagacgggcgcgtgcctg
atgagcccgctgccgggcgcgacgccgctgaagccgggctcgtgcaccaggccgctgccc
ggcgtgaagccgcagctggtggacgccgaaggcaaggtcctggacggggcgaccagcggc
aacctgtgcctgaccgacagctggcccggccagatgcggacagtctacggcgaccacgag
cggttcatcgtcacctatttcacgacctatccgggcaagtacttcaccggcgacggcgcc
cgccgcgacgaggacggctactactggatcaccggccgcgtggacgacgtgatcaacgtc
tcgggtcaccgcctgggcacggccgagatcgagagcgcgctggtgggccacgaggccgtc
gccgaggcggcggtcgtcggctacccgcacgagatcaagggccaggggatctactgctac
gtgacgctgaaggtgggcgagcacccctccgaggcgctgcaggccgacctgcggggctgg
gtccggcgcgagatcggcccgttcgcggcgcccgacgtgatccagttcgcgcccggcctg
cccaagacccggtcgggcaagatcatgcgccgcatcctgcgcaagatcgccgaggacgac
ctcggcaacctgggcgacacctcgaccctcgccgatccggcggtggtcgacgacctggtc
gcccatcgcgcaggggcgagcgcgggcgacgtcgtcgagctcgcgggccggaagctgccg
gccgccgagctcgagcagctcatcgtcgagaacaccccggtcgccgacgcggtcgtggtg
agcccgcggggcaagggcctgtggtgcttcgtggcgctggagccgggcttccagcccagc
gacatcctgaaggccgacatccgcgcggtgctgaagcgccaggtcggcgagcacgcagtt
cccgagttcgtctacgtcggccgcgatctgccccgttcggccggcggcgaggtcgtgcgc
ccgctcctgcaccgcatcgccgagggcgagcctgtgggcgacacgaagggcctgtccaac
ccggcggtgctggacgacctgctgaaggcgcgggccgaagctgtcgcctga

DBGET integrated database retrieval system