KEGG   Phenylobacterium zucineum: PHZ_p0066Help
Entry
PHZ_p0066         CDS       T00750                                 

Definition
(GenBank) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu00010  Glycolysis / Gluconeogenesis
pzu00260  Glycine, serine and threonine metabolism
pzu00680  Methane metabolism
pzu01100  Metabolic pathways
pzu01110  Biosynthesis of secondary metabolites
pzu01120  Microbial metabolism in diverse environments
pzu01130  Biosynthesis of antibiotics
pzu01200  Carbon metabolism
pzu01230  Biosynthesis of amino acids
Module
pzu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pzu_M00002  Glycolysis, core module involving three-carbon compounds
pzu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHZ_p0066
  Energy metabolism
   00680 Methane metabolism
    PHZ_p0066
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PHZ_p0066
Enzymes [BR:pzu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PHZ_p0066
Membrane trafficking [BR:pzu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PHZ_p0066
Exosome [BR:pzu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PHZ_p0066
  Exosomal proteins of melanoma cells
   PHZ_p0066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF3303 AAA_16
Motif
Other DBs
NCBI-ProteinID: ACG80009
UniProt: B4RI34
Position
unnamed:complement(72274..72978)
Genome map
AA seq 234 aa AA seqDB search
MRSLVLLRHGQSQWNAANRFTGWADVNLTPAGEAQAEAAGRLLRAQGLEFKTAFTSVLTR
AIRTLRIVLQASGQAFVPEHKTWRLNERHYGALTGLEKDEAAERFGAEQIARWRRGYSDR
PPPMGEAEHQALAQDRRYRGVPVPHTESLEDVQARLKPWRAQLDSALSAGPVLVVAHGNS
LRALLSDLLRLQPEEVRRLEIPLANPLVAELDDAGQTIALAYLDASRAAALPRA
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcctcgtcctcctccgccacggccagagccagtggaacgccgccaaccggttc
accggttgggccgacgtcaacctgacaccggcgggcgaagcccaggccgaggccgccggc
cggctgctccgcgcgcagggcttggagttcaagacggcgttcacctcagtgctcacccgg
gcgatccggaccctgcggatcgtgctgcaggcgagcggccaggccttcgtccccgagcac
aagacttggcgcctcaatgagcgccactacggcgccttgaccggcctcgagaaggacgag
gccgcggaacggttcggcgccgaacagatcgcccgctggcgtcgcggctattcggaccgg
ccgccgccaatgggggaagctgaacatcaggcgctggcgcaggaccgccgctaccgcggt
gtccccgtgccgcacacggaaagcctggaggatgttcaggcgcggctgaagccctggcgc
gcccagcttgacagcgccctctcggccggacccgtcctggtggtggctcacggcaacagc
cttcgcgccctgctgagcgacctcttgcgccttcagcccgaggaggtccggcggctcgaa
atccccctcgccaatcccctcgtggcggagctcgacgatgcggggcagacgatcgccctc
gcctacctggatgcgagccgcgccgcggcgctgccacgcgcctga

DBGET integrated database retrieval system