KEGG   Phenylobacterium zucineum: PHZ_p0117Help
Entry
PHZ_p0117         CDS       T00750                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu00010  Glycolysis / Gluconeogenesis
pzu00052  Galactose metabolism
pzu00500  Starch and sucrose metabolism
pzu00520  Amino sugar and nucleotide sugar metabolism
pzu00521  Streptomycin biosynthesis
pzu01100  Metabolic pathways
pzu01110  Biosynthesis of secondary metabolites
pzu01120  Microbial metabolism in diverse environments
pzu01130  Biosynthesis of antibiotics
pzu01200  Carbon metabolism
Module
pzu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pzu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHZ_p0117
   00052 Galactose metabolism
    PHZ_p0117
   00500 Starch and sucrose metabolism
    PHZ_p0117
   00520 Amino sugar and nucleotide sugar metabolism
    PHZ_p0117
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PHZ_p0117
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PHZ_p0117
Enzymes [BR:pzu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PHZ_p0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: ACG80060
UniProt: B4RI85
Position
unnamed:126487..127497
Genome map
AA seq 336 aa AA seqDB search
MTAARPQSELWSGLVADLGGTNTRFALVDRRGRLQASKTYPAAAFHSVDEGLARYLRDVA
PGAAPPAAVLAIAGQVTDGRARFSNLPWTADAAALRAAFSFRAVELINDFVAQALAAPRL
APEHLRPLGRPSKAQPGVIAVIGAGTGFGAAGLAPGPAGETPIASEAGHAGFAPADEFEL
RLWERLKRRFGRVSIERVLSGRGLVAIYEAVRDQGAITQPAEVVAAARQGENEAQQALSR
FVTIYGRVAGDLALTFGTRAGVYISGGIAPKILDWLERPAFREAFEDKGRLSGFVRSVPT
FAVTHPDPGLLGAARRLTELLEASAAAQDGCAEAHS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcggctcgaccccagagcgagttgtggtcaggcctggtggccgatctcggcggc
acgaacacccgcttcgcgctggtcgatcggcgcggtcgtcttcaggcgtcgaagacctat
ccggcggccgcgttccactcggtcgatgaaggcttggccaggtacctccgcgacgtcgcg
cccggcgcagccccgcccgcagcggtgctggcgatcgcaggccaggtgaccgacggtcgc
gcgcgcttctccaacctgccttggacggcggacgccgccgcgcttcgcgcggcgttctcc
ttccgcgcggtcgaactcattaacgacttcgtggctcaagccctggcggcgccgcgcctt
gcgccggagcacctgcggccacttgggaggccgagcaaggcgcaacccggcgtgatcgcg
gtcatcggcgccggcaccggctttggggcggcggggctcgcgcctggaccggctggcgag
acgccgatcgcttcagaagccggccacgccggcttcgcgcccgcggacgaattcgagctg
cggctgtgggagcgactgaagaggcgtttcggccgcgtctcgatcgagcgcgtgctgtcg
ggccgcgggctcgtcgcgatctatgaggccgtccgggaccagggggcgatcactcagcct
gccgaggtcgtcgcggctgcaaggcagggcgagaacgaagcgcagcaggcgctttcgcgg
ttcgtgacgatctacggccgcgtcgccggcgaccttgccctcaccttcgggactcgggcc
ggcgtctacatttccggcggaatcgcgccgaagatcctcgactggctggagaggcccgcc
ttccgtgaagcgttcgaggacaaagggcggttaagcggcttcgtccgatccgtgcccacc
ttcgcggtgacccacccggacccgggcctgctaggcgccgcacggcggctcacggagctc
ctagaggcatcggccgcggctcaggacggctgcgccgaagcgcactcataa

DBGET integrated database retrieval system