KEGG   Phenylobacterium zucineum: PHZ_p0129Help
Entry
PHZ_p0129         CDS       T00750                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu00790  Folate biosynthesis
pzu01100  Metabolic pathways
Module
pzu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PHZ_p0129
Enzymes [BR:pzu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PHZ_p0129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF ATP-synt_F EIF_2_alpha
Motif
Other DBs
NCBI-ProteinID: ACG80072
UniProt: B4RI97
Position
unnamed:complement(140302..141084)
Genome map
AA seq 260 aa AA seqDB search
MFALEHGFLSWSFLEMSGDFFLPDPAHSKPDRSSVVEDQFEPRNLHDPRRLKPDDDTSVG
QDLPPTAKNVLRPTQAEAEQAVRVLLRWAGDDPDREGLIETPARVARSYREILGGYDTDP
RSYLERVFEEIGGYDELVVLRDIPIASFCEHHMLPFTGKAHIGYLPSHRVVGISKLARVV
HGFARRLQIQEKLTAQIAETIQEVLQPKGVGVVIISEHSCMTMRGVNTPGSRLITSHLLG
AVRDDPRTREEFLALIHSGS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgcacttgaacatggattcctgagctggagttttctcgagatgagcggagatttt
ttccttcctgatcctgcacattccaagccggacaggtcatcggtcgtagaggaccagttc
gagccccgaaaccttcacgacccgcggcgattgaagcccgacgacgacaccagcgtcggg
caggacctgccgcccacggccaagaatgtgcttcggccgacgcaggcagaggccgagcaa
gccgtgcgggtgctcctgcgatgggccggcgatgacccggaccgcgagggactgatcgaa
acgccggcgcgcgtggcgcgctcctatcgggagatcttgggcggttacgacaccgacccg
cgaagttacctggagcgtgtattcgaagaaattggcgggtacgacgaacttgtcgtgttg
cgggacattcccatcgccagtttttgcgagcaccacatgctgcccttcaccggtaaggcg
cacatcggttacctgccgtcccatcgagtggtcggaatctcgaaactcgcacgcgtggtt
catggcttcgcgcggcggcttcagattcaggagaagcttacggcgcagatcgccgaaacg
atccaggaagtcctccagcccaaaggggtgggcgtcgttatcatttccgagcacagttgc
atgacaatgcgcggggtgaacacgcccggctcccggctgatcacaagccacctcttggga
gcggtgcgggatgatccaaggacacgggaagagttccttgcactgatccatagcggctcg
tga

DBGET integrated database retrieval system