KEGG   Phenylobacterium zucineum: PHZ_p0142Help
Entry
PHZ_p0142         CDS       T00750                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pzu  Phenylobacterium zucineum
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PHZ_p0142 (deoA)
Enzymes [BR:pzu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PHZ_p0142 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
unnamed:159719..161245
Genome map
AA seq 508 aa AA seqDB search
MSAPASEAGPPAPRLVARRLGLITQHEAVVLMRTDCHVCRAEGLSAKAQVAISANGREVY
ATLYQVDDDWLGQEEAGLSESLWARLGVGDGAEITVRHAPSLESMSSVRRRIYGQRLSDG
DLHGVVGDIAAGRYTDIHLAAFLTASSALALDHQETVALTRAMIDAGERLSWPGPVVVDK
HSVGGLPGNRTTPLVVAIVAACGLTMPKTSSRAITSPAGTADTMETLAPVDLDLPAIRRV
VEAEGGCVVWGGAVRLSPADDIFIRVERVLDVDTEGQLVASVLSKKIAAGSTHVVLDIPV
GPTAKVRTEDAAERLSGALSRVAAEFGLATRCVLSDGAQPVGRGVGPALEAHDVLAVLQN
QADAPPDLRRHACVLAGEALEFGGAAAAGEGLRLAEAVLADGRAWRKFLAICEAQGGLRT
PPSASYTRPLTASRGGRIVHINNRKIARLAKLAGAPDVKAAGVRLMARLGDEVASGQPWV
MIHADSPGELEYALDYANRNPDLMEVEA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgctccggcgtcggaggctggcccgcccgccccgaggctcgtggcgcgtcgcctg
ggcttgatcacccagcatgaagccgtggtgctgatgcgcaccgactgtcacgtctgtcgg
gcggaaggcctctcggccaaggcgcaggtggcgatctccgccaacggccgcgaagtctac
gccacgctttaccaggtcgacgatgactggctcggccaggaggaggcggggctctcggaa
tcgctttgggcgcgtctgggcgtcggcgacggcgccgagatcaccgtgcggcacgcgcca
tcgctcgaatcgatgtcgagcgtgcggcgacgcatttacggccagcggctttcggacggt
gatctgcatggcgtggtcggggacatcgccgccggccggtacaccgacatccatctggcg
gcgttcctgacggcgtcctccgcgcttgccctcgaccaccaggagaccgtcgccctgact
cgggcgatgatcgacgccggcgagcggctgagctggccgggcccggtcgtggtcgacaag
cactcggtgggggggcttcccggcaaccgcacgacgccgctggtggtcgccatcgtcgcg
gcctgcggcctcaccatgcccaagacctcgtcgcgggcgatcacttccccggctggcacg
gccgacaccatggagaccctggcccctgtggacctcgacctgccggcgatccgccgggtc
gtggaggcggaaggcggctgcgttgtgtggggcggggcggtgcggctgagcccggccgac
gacatcttcatccgggtggagcgggtgctggatgtcgacaccgagggccagctcgtcgcc
tccgtgctctcgaagaagatcgccgccggttcgacccacgtcgtgctcgacattccggtc
ggccccacggccaaggtcaggacggaggacgccgccgagcggctctccggagccctctcg
agggtcgctgccgaattcggactggccacgcgctgcgtgctctcggacggcgcgcagccg
gtgggccgaggggtcggcccggccttggaggcgcacgacgtgctggcggtgctgcagaac
caggccgacgcgccgcccgacttgcgtcgccatgcctgcgtgctggccggcgaggcgctg
gaattcggcggcgccgcggcggccggcgagggcctgcggctggccgaggcggtgctcgcc
gacggccgcgcctggcgcaagttcctggccatctgcgaagcgcaaggcgggctgcggacg
ccgcccagcgccagctacacccggcccctgacggcgagccgcggcggccggatcgttcat
atcaacaatcgcaagatcgcccggctcgccaagctggccggcgcaccggacgtgaaggcg
gccggcgtgcggctgatggcgaggctgggggacgaggtggcctctggccagccctgggtg
atgatccatgccgattcgcccggtgagctcgagtacgcgctcgactacgccaaccgcaac
ccggacttgatggaggtcgaagcgtga

DBGET integrated database retrieval system