KEGG   Rahnella aquatilis HX2: Q7S_00090Help
Entry
Q7S_00090         CDS       T01850                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
raa  Rahnella aquatilis HX2
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:raa00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:raa00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:raa00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(20017..22143)
Genome map
AA seq 708 aa AA seqDB search
MENQIVHLTGGNTSLIVRCMPYAEILYWGNRLSQFSANDVISLSRAVPNGRIDVEAPVNV
SADSGRGSFGTPGMEGHRDGLDWSPVFNTTQVKHDENQLTITTEDPIAGLQFRSELRLDN
SGVLQARNSLTNLKPGTYQVTRLAVTLPLPERAAEVMAFHGRWIKEFQPHRTRLDHGGII
QENRRGKTSSEYFPAMMIGHPGFSEEQGEVWGMHLGWSGNHRLRADIKIDGRRLVQAEAL
YLPGEQRLGQGETLETPWLYASYSASGLNRMSQQFHQFVREQILRFPAEKPRPVHLNTWE
GIYFDHDPDYIMQMATESAALGVERFIIDDGWFRGRDHDRAALGDWYLDEKKYPNGLKPV
IDHVKKLGMEFGIWVEPEMINPDSDLYRAHPDWLLALPGYQQPSGRHQFVLDLNNPQVFD
YLLERMSWLLGEHDVDYVKWDMNREIVQPGHEGRAALTSQTQQFYRLLDALGERFPQIEF
ESCASGGGRIDFEVLKRSHRFWTSDNNDALERQKIQRGMSYFFPPEVMGSHIGNKLCHAT
SRQHSIEFRGLTALFGHMGIELDPVKEGDTERAGFAKYTRLHQQLRPLLHSGDVYRVDTH
DETVLINGVVSESADRAVFLVSQLAMPTWSLPGVLRVPGLRSDARYRVTVLDEPPLLAGG
GSGHTMRVQPAWLHESPVLSGEWLANAGLALPVLDPESALLLGFEEIR
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaccagattgttcatttaaccggcgggaataccagcctgatcgtgcgttgcatg
ccttacgccgaaattctttactggggaaaccgcctcagccagttttcagcgaatgacgtt
atttcgctgagccgcgcggtgcccaatggccggattgatgtcgaagcgccggtgaatgtc
agcgccgactcagggcgcggttcattcggcacaccgggcatggaaggccatcgcgacggg
ctggactggtcgccggtattcaataccacgcaggtaaagcatgatgaaaaccagctcacc
attaccaccgaagacccgatcgccggactgcaatttcgcagcgagttacgcctcgataac
agcggcgttttgcaggcacgtaacagcctgaccaacctcaaacccggcacgtatcaggtg
acgcgactggccgtgacgctgccgctgccggaacgcgccgccgaagtgatggcctttcat
ggccgctggatcaaagagttccagccgcaccgcacacggctggatcacggcggcatcatt
caggaaaaccgtcgcggcaaaacctcttccgaatattttccggcgatgatgatcggtcat
ccgggtttcagcgaagaacagggcgaagtctggggaatgcatctggggtggagcggcaac
cacaggctgcgcgccgacatcaaaatcgacggccgccgtctggtgcaagccgaagcgttg
tatctccccggtgagcaacgactcgggcaaggcgaaactctggaaacgccctggttgtat
gccagttattccgccagcggcctgaaccgcatgagtcagcaattccaccagtttgtgcgt
gaacagattttgcgcttcccggctgagaaaccgcgtccggtacatctcaatacctgggaa
gggatttatttcgatcacgatcctgactacatcatgcagatggcgaccgaatccgccgcg
ttaggtgtggaacgcttcattatcgacgacggctggttccgtggccgcgaccatgaccgc
gccgcgctcggtgactggtatctcgacgagaagaaatacccgaacggcctgaaaccggtg
atcgaccatgtaaaaaaactcgggatggaatttggcatctgggtcgagccggaaatgatt
aacccggattccgatttataccgcgcccaccctgactggctgctggcgttgccgggctat
cagcaaccgagcggacgtcaccagttcgtgctcgatctgaacaatccgcaggtctttgat
tatctgctggaacgcatgagctggctgcttggcgagcacgacgtcgattatgtgaaatgg
gacatgaaccgtgaaattgtccagcccggccatgaaggccgcgcggcactgacgtcacaa
acgcagcagttttaccgcctgctcgacgcgctgggcgaacggttcccgcagattgagttt
gaatcctgcgcgtccggcgggggtcgcattgacttcgaggtgctcaaacgcagccaccgt
ttctggacatccgacaataacgacgcgctggagcggcagaaaattcagcgcggcatgagc
tatttcttcccgccggaagtgatggggtcgcacatcggcaacaagctgtgccatgccacc
tcacgccagcacagcattgaatttcgcggcctgacggcgctgttcggtcacatggggatt
gagctggatccggtgaaagaaggcgataccgaacgcgccggttttgcgaaatacacccgc
cttcatcaacaacttcgcccgttattacacagcggcgacgtttaccgcgtggatacacac
gacgagacggtgctgatcaatggcgtggtcagtgaaagcgccgatcgcgcggtattcctg
gtcagccaactggcgatgcccacctggtcgttacccggtgtgttgcgggtgccggggcta
agatctgatgcgcgttatcgcgtgacggtgctggatgaaccgccattgctggcgggtggc
ggcagcggtcacaccatgcgcgtacaaccggcgtggctgcatgaatctccggtattgagc
ggcgaatggctggcaaatgccgggctggcactgccggtgttggatccggaaagtgccctg
ctgctgggcttcgaagaaatcagataa

DBGET integrated database retrieval system