KEGG   Rahnella aquatilis HX2: Q7S_00090Help
Entry
Q7S_00090         CDS       T01850                                 

Definition
(GenBank) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00052  Galactose metabolism
raa00561  Glycerolipid metabolism
raa00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Q7S_00090
  Lipid metabolism
   00561 Glycerolipid metabolism
    Q7S_00090
   00600 Sphingolipid metabolism
    Q7S_00090
Enzymes [BR:raa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Q7S_00090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Glyco_hydro_31 GHL10 Melibiase_2 NuiA
Motif
Other DBs
NCBI-ProteinID: AFE56290
UniProt: H8NLY2
Position
complement(20017..22143)
Genome map
AA seq 708 aa AA seqDB search
MENQIVHLTGGNTSLIVRCMPYAEILYWGNRLSQFSANDVISLSRAVPNGRIDVEAPVNV
SADSGRGSFGTPGMEGHRDGLDWSPVFNTTQVKHDENQLTITTEDPIAGLQFRSELRLDN
SGVLQARNSLTNLKPGTYQVTRLAVTLPLPERAAEVMAFHGRWIKEFQPHRTRLDHGGII
QENRRGKTSSEYFPAMMIGHPGFSEEQGEVWGMHLGWSGNHRLRADIKIDGRRLVQAEAL
YLPGEQRLGQGETLETPWLYASYSASGLNRMSQQFHQFVREQILRFPAEKPRPVHLNTWE
GIYFDHDPDYIMQMATESAALGVERFIIDDGWFRGRDHDRAALGDWYLDEKKYPNGLKPV
IDHVKKLGMEFGIWVEPEMINPDSDLYRAHPDWLLALPGYQQPSGRHQFVLDLNNPQVFD
YLLERMSWLLGEHDVDYVKWDMNREIVQPGHEGRAALTSQTQQFYRLLDALGERFPQIEF
ESCASGGGRIDFEVLKRSHRFWTSDNNDALERQKIQRGMSYFFPPEVMGSHIGNKLCHAT
SRQHSIEFRGLTALFGHMGIELDPVKEGDTERAGFAKYTRLHQQLRPLLHSGDVYRVDTH
DETVLINGVVSESADRAVFLVSQLAMPTWSLPGVLRVPGLRSDARYRVTVLDEPPLLAGG
GSGHTMRVQPAWLHESPVLSGEWLANAGLALPVLDPESALLLGFEEIR
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaccagattgttcatttaaccggcgggaataccagcctgatcgtgcgttgcatg
ccttacgccgaaattctttactggggaaaccgcctcagccagttttcagcgaatgacgtt
atttcgctgagccgcgcggtgcccaatggccggattgatgtcgaagcgccggtgaatgtc
agcgccgactcagggcgcggttcattcggcacaccgggcatggaaggccatcgcgacggg
ctggactggtcgccggtattcaataccacgcaggtaaagcatgatgaaaaccagctcacc
attaccaccgaagacccgatcgccggactgcaatttcgcagcgagttacgcctcgataac
agcggcgttttgcaggcacgtaacagcctgaccaacctcaaacccggcacgtatcaggtg
acgcgactggccgtgacgctgccgctgccggaacgcgccgccgaagtgatggcctttcat
ggccgctggatcaaagagttccagccgcaccgcacacggctggatcacggcggcatcatt
caggaaaaccgtcgcggcaaaacctcttccgaatattttccggcgatgatgatcggtcat
ccgggtttcagcgaagaacagggcgaagtctggggaatgcatctggggtggagcggcaac
cacaggctgcgcgccgacatcaaaatcgacggccgccgtctggtgcaagccgaagcgttg
tatctccccggtgagcaacgactcgggcaaggcgaaactctggaaacgccctggttgtat
gccagttattccgccagcggcctgaaccgcatgagtcagcaattccaccagtttgtgcgt
gaacagattttgcgcttcccggctgagaaaccgcgtccggtacatctcaatacctgggaa
gggatttatttcgatcacgatcctgactacatcatgcagatggcgaccgaatccgccgcg
ttaggtgtggaacgcttcattatcgacgacggctggttccgtggccgcgaccatgaccgc
gccgcgctcggtgactggtatctcgacgagaagaaatacccgaacggcctgaaaccggtg
atcgaccatgtaaaaaaactcgggatggaatttggcatctgggtcgagccggaaatgatt
aacccggattccgatttataccgcgcccaccctgactggctgctggcgttgccgggctat
cagcaaccgagcggacgtcaccagttcgtgctcgatctgaacaatccgcaggtctttgat
tatctgctggaacgcatgagctggctgcttggcgagcacgacgtcgattatgtgaaatgg
gacatgaaccgtgaaattgtccagcccggccatgaaggccgcgcggcactgacgtcacaa
acgcagcagttttaccgcctgctcgacgcgctgggcgaacggttcccgcagattgagttt
gaatcctgcgcgtccggcgggggtcgcattgacttcgaggtgctcaaacgcagccaccgt
ttctggacatccgacaataacgacgcgctggagcggcagaaaattcagcgcggcatgagc
tatttcttcccgccggaagtgatggggtcgcacatcggcaacaagctgtgccatgccacc
tcacgccagcacagcattgaatttcgcggcctgacggcgctgttcggtcacatggggatt
gagctggatccggtgaaagaaggcgataccgaacgcgccggttttgcgaaatacacccgc
cttcatcaacaacttcgcccgttattacacagcggcgacgtttaccgcgtggatacacac
gacgagacggtgctgatcaatggcgtggtcagtgaaagcgccgatcgcgcggtattcctg
gtcagccaactggcgatgcccacctggtcgttacccggtgtgttgcgggtgccggggcta
agatctgatgcgcgttatcgcgtgacggtgctggatgaaccgccattgctggcgggtggc
ggcagcggtcacaccatgcgcgtacaaccggcgtggctgcatgaatctccggtattgagc
ggcgaatggctggcaaatgccgggctggcactgccggtgttggatccggaaagtgccctg
ctgctgggcttcgaagaaatcagataa

DBGET integrated database retrieval system