KEGG   Rahnella aquatilis HX2: Q7S_00500Help
Entry
Q7S_00500         CDS       T01850                                 

Definition
glycoside hydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
raa  Rahnella aquatilis HX2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Q7S_00500
Enzymes [BR:raa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Q7S_00500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(107147..108160)
Genome map
AA seq 337 aa AA seqDB search
MSLFRRYSLVLWFGLIFAFFSSAVMAQDAGWSAYKSRFLMPDGRIIDTANKNVSHTEGQG
FSMLLAVFNDDQATFDKLWQWANTTLYRKDIGLYSWRYDPNSTPHVADINNASDGDTLMA
WALLLAGDKWNDSRYTKASEKLQTALIKYNVIDYAGYKVMLPGVKGFNQTSNVTVNPSYF
IFPAWQAFYAHSHLKVWKDLDESSTAMLSKMAFGDFRLPTDWVDMQADGTLKPASRWPTR
FSYDAVRIPLYLGWAHPGSPQLAPFILWWQKSPRDATPAWIDVMTGTKAGYNMSPGLLAV
RDFTMANAGAISPNLAPKDDYYSSTLQLLSWWASHKG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttatttcggcgctacagcctggtgctgtggttcggccttattttcgcgtttttc
agttccgctgtaatggctcaggatgctggctggtctgcgtataaaagtcgctttctgatg
ccagatggacgaatcattgataccgccaataaaaacgtcagtcacaccgaaggtcagggt
ttcagtatgctgctcgcggtgttcaatgacgatcaggcgacgttcgacaagctgtggcag
tgggcaaacacgacgctctatcgcaaagatatcggcctgtattcatggcggtatgacccg
aacagcactccgcatgtggcagatatcaacaacgcctctgatggcgatacgctgatggcc
tgggcgctgttgctggcgggtgataagtggaacgacagccgttacaccaaagcctctgaa
aaattgcagacggcgctgatcaaatacaatgtgattgattacgccggttacaaagtgatg
ctgccgggcgtgaagggtttcaatcagaccagcaacgtaaccgtcaatccgtcctatttc
atcttcccggcctggcaggcattttatgcgcacagccatttgaaagtctggaaagatctg
gatgaaagcagcaccgcgatgctcagtaaaatggcgtttggcgatttccgcttaccgacg
gactgggtggatatgcaggccgatggcaccctgaaaccggccagccgctggccaacgcgt
ttcagttacgatgccgtgcgtatcccgctgtatctcggctgggcgcatcccggcagcccg
caactggcaccgtttattctgtggtggcaaaaatccccacgcgacgccacacccgcctgg
attgatgtcatgaccggcaccaaagcgggctacaacatgtcaccgggattattagccgtg
cgcgatttcaccatggccaacgctggcgccatcagcccgaacctggcaccgaaagacgat
tactactcttccaccctgcaactgctgagctggtgggcaagtcataaagggtaa

DBGET integrated database retrieval system