KEGG   Rahnella aquatilis HX2: Q7S_00690Help
Entry
Q7S_00690         CDS       T01850                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase subunit alpha
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
raa  Rahnella aquatilis HX2
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Q7S_00690 (ebgA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Q7S_00690 (ebgA)
Enzymes [BR:raa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Q7S_00690 (ebgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(152060..155116)
Genome map
AA seq 1018 aa AA seqDB search
MNNWENIEKQSENRLPPRASFFSYENPQAALRFDRAASHGFQLLSGRWQFRFFEHPALVP
DEFYNQPMTAWGHITVPGMWQMEGHGQLQYTDEGFPFPIDVPYVPTNNPTGAYQQRFTLD
AAWTGKQTLIKFDGVETYFEVYVNGHYVGFSKGSRLCAEFDISASVKPGENLLSVRVLQW
ADSTYIEDQDMWWMAGIFRDVYLIGQDPVHLNDFTVVTTFDENYCDAVLNIDAVLRNLLQ
PVSGYRLHAQLFDDGVCVAQLSADNLNIGDETRCRLDIPVSHPRQWNAEHPELYQLLLTL
YDDTGQMISVVPQRVGFRDIRVRDGLFYVNGRYLKLHGVNRHDHDHRKGRAVDMARVERD
IILMKQHNINAVRTAHYPNDPRFYELCDIYGLFVMAETDLESHGFANVGDLSRISDDPHW
EHAYVERIGRHVMAQKNHPSIIMWSLGNESGYGCNIRAMAKHCKALDPTRLVHYEEDRDA
EVTDVISTMYSRVQMMNAFGEYPHAKPRIICEYAHAMGNGPGGLAEYQAVLNRHDSLQGH
YIWEWCDHGLLETGENGQMRYTYGGDYGDYPNNYNFCMDGLIYPDQTPGPGLREYKQVLC
PVGVSLRGGALHIKNRYWFSSLEDITLSLTVQVAGRGLETREISLPHLQPGEGETLALPE
FPASGQEVFLNVGIRKNSPTVYSEAQHPLGQYQMLLQAARPSAMKPAPQKSATLLCDEQK
HQLIVSGEGFRLAFSRLDGELQSWQVDDEEITGRAPKLNFFKPVIDNHKQEFEGLWQPHH
LHIMQQHFRQMHWARQQDDVVIEVQSIIAPPVFDFGMRCTYRWQISPQGAVTLDLSGSPY
GNFDSIIPKIGLDFGVSRRFTQVEYYGRGPDENYQDSCQANLIGHYQQPVSRLFENYPMP
QDNGNRQDIRWLSLCDDAGKGIFIQPRQPLNFSLWPYSAQMLQQAQHIDELTPDGCLTLN
LDHKISGLGSNSWGSEVLDSYRVYFSAFRYGFTMVPFSQHDTNSQQLAEFTFHPAEEN
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
gtgaataattgggaaaatatcgagaagcagtcggagaaccgtttaccgccacgcgcctcc
tttttcagctatgaaaatccacaggcggcgctgcgtttcgatcgcgcagccagtcacggc
tttcagttgctcagcggccgctggcagttccgctttttcgagcacccggcgttagtcccg
gatgaattctacaatcagccgatgactgcatggggtcacatcaccgtccccggcatgtgg
cagatggaaggccacggccagctgcaatataccgatgaaggtttccccttcccgatcgac
gttccttacgttcccactaataacccgaccggcgcgtatcagcagcgttttaccctcgat
gcagcctggacaggcaaacaaacgctgatcaaatttgacggcgtggaaacctatttcgag
gtgtatgtgaacgggcactacgtcggattcagcaaaggcagccgcctgtgcgcagagttc
gatatcagcgccagcgtgaaaccgggtgaaaacctgctgtcggtgcgtgttttacagtgg
gcggattcaacatatatcgaagatcaggatatgtggtggatggcgggaattttccgcgat
gtgtatctcatcggtcaggatccggttcatcttaacgatttcaccgtagtcaccacattc
gatgaaaactactgcgacgccgtgctcaatattgatgccgtgctgcgtaatttactccaa
cccgtcagcggttatcgtctgcacgcgcagttattcgacgatggcgtctgcgtggcacag
ttatcagcagataacctgaatatcggcgatgaaacgcgctgtcgcctggacattccggtc
agtcatccgcgccagtggaacgcggaacatcctgagttatatcagctgttgctgacgctg
tatgacgacacgggacagatgatttcggtggtacctcagcgcgttggctttcgtgacatc
cgcgtacgcgacgggctgttttacgtcaacggacgttatctcaagctgcacggcgtaaac
cgccacgaccacgatcaccgcaaagggcgtgcggtcgatatggcgcgggtggaacgcgat
atcatcctgatgaaacagcacaatattaacgcggtgcgcaccgcgcattacccgaatgat
cctcgcttttacgagttgtgcgatatctacggattattcgtgatggccgaaacggatctg
gaaagtcacggtttcgcgaacgtcggcgatctgagccgcatctccgacgatccgcactgg
gaacacgcctatgtggagcgtatcgggcgtcacgtcatggcgcaaaaaaaccacccgtcg
atcattatgtggtcgcttggcaacgaatccggttatggctgcaatatccgcgccatggcg
aaacactgtaaagccctcgatccgacgcgtcttgttcactacgaagaagatcgcgacgcc
gaagtgaccgacgtcatcagcaccatgtattcccgcgtacagatgatgaatgcgttcggc
gaatacccgcacgccaaaccgcgcatcatctgcgaatacgcgcatgcaatgggcaacggt
cccggcggattagccgaatatcaggccgttctgaatcgccatgacagccttcaggggcat
tacatctgggaatggtgcgatcacggattgctggaaaccggtgaaaacggccagatgcgt
tatacctacggcggcgattacggcgattatccaaacaactacaacttctgcatggacggg
ctgatttaccccgaccagacgcccggccccggcctgcgcgaatataaacaggtgctgtgc
ccggtcggcgtcagtctccgcggcggcgcgctgcacatcaaaaatcgttactggttcagc
tcactggaagacatcacgctgtcgctgaccgttcaggtcgccggacgcggcctcgaaacc
cgcgaaatttccctgccgcacctgcaacccggcgaaggcgaaacgctggcgctgccagaa
tttcccgccagcggtcaggaagttttcctgaatgttggcattcgcaaaaacagcccgacg
gtgtacagcgaagcgcaacatccgctcggacagtatcagatgctgttgcaggcagcccgc
ccgtcagccatgaaacctgcgccgcaaaagtccgcaacgctgttatgtgatgagcaaaaa
catcagcttatcgtcagcggcgagggcttccggctggcattttcccgtctggacggcgaa
ctgcaaagctggcaagtggatgacgaagagatcacaggccgtgcgccgaaactcaatttc
tttaagccggtcatcgacaaccataaacaggagttcgaaggcctctggcagccccatcat
ctgcatatcatgcaacagcatttccggcagatgcactgggcgcgccagcaggacgacgtc
gtcattgaagtgcaaagcatcattgcgccgcctgttttcgatttcggtatgcgctgcact
tatcgctggcagatatcgcctcagggcgccgtcaccctcgatttatccggctcgccttac
ggtaatttcgattcaattatcccgaagatcggcctcgattttggcgtcagccgtcgtttc
acgcaggtggagtattacgggcgcgggccggatgaaaactatcaggacagctgtcaggcc
aatctcatcggccattatcagcagccggtgagccgtttatttgaaaattacccgatgccg
caggacaacggtaaccggcaagatatccgctggctgagtctgtgcgatgacgctggaaaa
gggattttcattcagccgcgccagccgctcaatttcagcctgtggccatacagtgcgcag
atgctgcaacaggcgcagcatattgatgaactgacgccggacggctgcctgaccctcaat
ctcgatcacaaaatttccggtctgggctccaattcctggggttccgaagtgctcgattct
tatcgcgtctatttctcggcattccgctacggcttcacgatggtgccgttcagccagcat
gacaccaacagccagcagcttgcggaattcacctttcatcccgcggaggaaaactga

DBGET integrated database retrieval system