KEGG   Rahnella aquatilis HX2: Q7S_00970Help
Entry
Q7S_00970         CDS       T01850                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
raa  Rahnella aquatilis HX2
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q7S_00970
Enzymes [BR:raa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Q7S_00970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
220181..221563
Genome map
AA seq 460 aa AA seqDB search
MKYAFPKEFWWGSASSAPQTEGETLSHGKSATVWDHWYSQQPTRFHNDVGPQDTSTFYKN
WREDIALLKQLNHNTFRTSISWARLIPNGRGEVNQEAVTFYNQVIDEMLAQGVQPFINLF
HFDMPMAMQELGGWENRDVVQAYAKYADTCFELFGDRVKHWFTFNEPVVPVEGGYLYDFH
YPNVVDFKRAATVAYHTMLAHSLAVKAYRARNSGGEIGIILNLTPSYPRSQNPADLKAAN
IADLMFNRSFLDPALRGEYPQELVELLNKYDQLPACQQGDKALLQQGVVDLLGINYYQPR
RIQCRDSMVNPESPFMPEWFFDNYVMPGRKMNPHRGWEIYEQGIYDILTNLRENYGNPRC
FISENGMGVENELRFEQAGRIDDDYRIEFVSGHLKWLHRALQEGSGCLGYHMWTFIDCWS
WMNAYKNRYGFIQLDLETQKRTVKKSGEWFAAVSKNNGFD
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgcatttccaaaagaattctggtggggcagtgccagttcagcgccgcagacg
gaaggtgaaaccctgagccacggaaaaagcgcgacggtgtgggatcactggtattcacaa
cagccgacgcgctttcacaatgacgtcggtccgcaggatacctcgacgttttacaaaaac
tggcgcgaagatatcgcgctgctgaaacagctcaatcacaacaccttccgcacctcgatt
tcctgggcgcgtttgatccccaacgggcgtggtgaagtgaatcaggaagcggtcacgttt
tataaccaggtgatcgacgaaatgctggcgcagggcgtacagccgtttatcaatctgttc
cactttgatatgccgatggcgatgcaggaactcggcggctgggaaaaccgggacgtcgtg
caggcttacgcaaaatacgccgatacctgtttcgagctgttcggtgaccgcgtgaagcat
tggtttacgttcaacgaaccggtggtgccggtggaaggcggttatttgtatgatttccat
tacccgaacgtggtggatttcaaacgggctgccaccgtggcgtatcacactatgctggcc
cattcgctggcagtgaaggcctatcgcgcccgcaattctggcggtgaaatcggcattatt
cttaaccttacgccgtcttatccgcggtcacagaatccggctgacctgaaagccgctaac
attgcggacctgatgtttaaccgcagcttcctcgatccggcgctgcgcggtgaatatccg
caggaactggtggaattgctgaacaaatacgatcagcttccggcctgccagcagggcgat
aaagcactgctgcaacagggtgtggtggatttactcggcatcaactattaccagccgcgc
cgtattcagtgccgcgacagtatggttaatccggaaagtccgtttatgccggaatggttc
ttcgataactatgtcatgccgggacgtaaaatgaacccgcaccgtggctgggaaatctac
gagcagggcatttacgatattctgaccaatctgcgtgaaaactacggtaatccgcgctgt
ttcatttccgaaaacggcatgggtgtggaaaatgaactgcgctttgaacaggcgggacgg
attgatgatgattaccgcatcgagtttgtcagcgggcacctgaaatggttgcaccgcgcc
ttgcaggaaggcagtggttgtctgggttatcacatgtggacatttattgattgctggtca
tggatgaatgcctataaaaaccggtatggtttcatccagctggatctggaaacgcagaag
cgtacggtgaagaaaagcggcgaatggttcgcggcggtgtctaaaaataacggtttcgat
taa

DBGET integrated database retrieval system