KEGG   Rahnella aquatilis HX2: Q7S_01015Help
Entry
Q7S_01015         CDS       T01850                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
raa  Rahnella aquatilis HX2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Q7S_01015
Enzymes [BR:raa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Q7S_01015
Exosome [BR:raa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Q7S_01015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
228955..231138
Genome map
AA seq 727 aa AA seqDB search
MSVLPDQHVINQIISGHYADPFSLLGMHSVAAGLEVRALLPDADQVWVIDVEKGKQVAEL
RRYDDRGFFVGLIPRRKNAFRYKLEVRWGENLHVIDDPYRFGTLLQELDIWLLAEGTHLR
PYEKLGAHLQTLDDVDGVSFAVWAPNATRVSVVGEFNFWDGRRHPMRQRRENGIWELFIP
AVREGQLYKFEIIDCRGHVSLRADPYAFEAQMRPDTASCVRKLPDVVPHSESRKKANALN
QPVSVYEVHLGSWRRHTDDNFWLSYGELAEQLVSYAKWMGFTHIELMPVNEHPFDGSWGY
QPLGMYAPTRRFGTPMEFKAFVDAAHNAGLNVILDWVPGHFPSDTYGLAQFDGTALYEYA
DPREGYHQDWNTLIYNYGRHEVRNYLAGNGFYWIERFGIDGLRVDAVASMIYRDYSRKAG
EWIPNYYGGRENLEAISFLKYTNQTIGRELGGAVTLAEESTDYPGVTMPPDANGLGFHYK
WNMGWMHDSLTYMQLDPVHRKYHHNLMTFGVLYAYSENFILPLSHDEVVHGKKSLLDKMP
GDVWQKFANLRAYYGFMWAHPGKKLLFMGNEFAQGREWNFDASLDWHLLDDPSGWHSGVQ
HLVRDLNQTYQANAPLYELDYNPRGFEWLVVDDHENSIFAFARRDENGGEVIVISNFTPV
PREHYRIGISQPGRYHEILNTDSHFYRGSNVGNGCDIYSENIGHHQRDHSISVTIPPLAT
VYLRREA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtacttcccgatcagcacgtcattaaccaaattatatctggccactacgctgat
cctttttctcttttgggtatgcattctgtggccgccgggctggaagtgcgtgccctgttg
ccggatgcggatcaggtctgggttattgatgtagaaaaaggtaaacaggtggcggaactg
cgtcgttacgatgatcgtggtttctttgtcggcctgatcccgcggcgtaaaaatgccttt
cgttacaagctggaagtccgctggggcgagaatctgcatgtgattgacgatccgtaccgg
ttcggcacattgttgcaggaactggatatctggttgttggcggaaggcacgcacctgcgg
ccatacgaaaaactcggcgcacatctgcaaacgctggatgacgtcgatggtgtcagtttt
gccgtctgggcaccgaacgccacgcgggtttccgtcgtgggtgaattcaacttctgggac
ggccgccgacacccgatgcgccagcgccgtgaaaatggtatctgggaactcttcattccc
gccgtccgcgaaggtcaactgtataaattcgaaattatcgactgccgcgggcatgtcagc
ctgcgcgccgacccttatgcttttgaggcgcagatgcgtccggatactgcctcgtgcgtg
cgtaaattaccggatgttgtgccgcattcagaaagccgaaagaaagccaatgcgctgaat
cagccggtttccgtgtatgaagtgcacctgggttcctggcgtcgtcataccgatgataat
ttctggctcagctatggtgaactggccgagcaattagtctcatatgccaaatggatgggt
tttacgcacatcgaactgatgccggtcaacgaacatccgttcgacgggagctggggttat
cagccgcttggcatgtatgcgccgacccgtcgtttcggcacgccgatggaattcaaagcc
tttgttgatgccgcgcataacgccgggctgaacgtcattctcgactgggtgccgggacat
tttccgagcgacacctatggtttagcgcagtttgacggcaccgcgctgtacgaatatgcc
gatccccgtgaaggttatcatcaggactggaacacgctgatttataactatggccgccat
gaagtgcgtaactatctggcaggaaatggtttttactggattgaacggtttggcattgac
ggcctgcgtgtcgatgcggtggcttccatgatttaccgcgattacagccgtaaagccggg
gagtggatcccgaattattacggtggccgcgaaaacctcgaagccatttccttcctgaaa
tacaccaaccagaccattggtcgtgaactcggcggtgcggtgacgctggcggaagaatcg
accgattatcccggcgtcaccatgccgccggatgctaacgggctgggtttccattacaag
tggaatatgggctggatgcacgattccctgacctatatgcagcttgatccggttcaccgc
aaatatcatcacaacctcatgacattcggcgtgctttacgcttacagcgagaacttcata
ttgccgctgtcgcacgacgaagtggtacacggtaaaaaatccttgctggataaaatgccc
ggcgatgtgtggcagaagttcgccaacctgcgcgcctactacggctttatgtgggcacat
ccgggtaagaaactgctgtttatgggcaatgaatttgcgcaggggcgtgagtggaatttt
gacgccagcctcgactggcatctgcttgacgatccaagcggctggcacagcggcgtacaa
catctggtacgcgacctgaaccagacctatcaggccaatgcgccgttgtatgagctcgat
tacaacccgcgcggtttcgaatggctggtggtcgacgatcacgaaaactcgattttcgcc
tttgcccgccgtgacgaaaatggcggtgaagtgatcgtcatcagtaactttacgccggtt
ccgcgtgagcattatcgcataggcatcagtcagcctgggcgttatcacgaaatcctcaat
accgattcgcatttctaccgtggcagtaatgtcggcaacggttgcgatatttacagtgaa
aatattggccatcatcagcgtgaccattcgatcagcgtgactattccgccgctggcgacg
gtttatttgcgaagggaggcgtaa

DBGET integrated database retrieval system