KEGG   Rahnella aquatilis HX2: Q7S_01120Help
Entry
Q7S_01120         CDS       T01850                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
raa  Rahnella aquatilis HX2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Q7S_01120 (malQ)
Enzymes [BR:raa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Q7S_01120 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
255179..257254
Genome map
AA seq 691 aa AA seqDB search
MEDKQLAEAARRAGIVDSFINMTDDVETVSDDTRVALLAAMGRDPADVPEITPVPPVKVF
TQGKKVLLTPEGSGAFQWQLTQENGSETQGEILTGNVLNLGAALPAGYHQLTLSQNDNVW
PCRIIVAPTRCYEPEALLAGEKLWGATVQLYTLRSENNWGAGDFGDLKKMVEEVGKRGGA
FVGLNPIHALYPANPQSASPYSPSSRRWLNLTYIDVNAVEEFTASREAQDWWHSTETREA
LLQARSTEFVDYPLVMALKSAALKLAWPLFCELPEDSPRKQDFRRFVALGGDSLRQQALF
DALHTHLRDLDLGQWGWPVWPEVYRDAKSAQVREFSERYAGEIEFYQWQQWLAQMQFSAC
YQRSVELKMPIGVYRDLAVGVAQGGAETWSDPALYCLNATIGAPPDILGPQGQNWGLPPI
DPHEMKARAYQPFIDLLRANMAECGALRIDHVMGLLRLWWIPAEQEAGSGAYVRYPLEDL
LGVLALESQRHQCMVIGEDLGTVPKEILASLRDSGVYSYKVLYFEHDKHFLYRPPEDYVS
QAMATVTTHDLPTLRGYWEGGDLTLGASLGVYPDPQVLEKLRGERERSKQGLLNALHLTQ
CVPKSISRSAENMPMTPLLNLGLQRYLAGSASALLGLQPEDWLDMDLPVNVPGTNTEYPN
WRRKLTRTLEDMFADEHIDALLSDLNQRRQA
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggaggacaagcaactcgctgaggccgcgcgccgggcaggcattgtagacagtttcatt
aatatgacggatgacgtggaaacggtgtcagatgacacgcgcgtcgccttgctggcggcg
atggggcgtgatccggctgacgtgccggaaatcacgcccgtgccgccggtcaaagtgttt
acacaaggcaaaaaagtgttgctcacgccggaaggcagtggcgcatttcaatggcaactg
acgcaggaaaatggcagcgagacgcagggcgaaatcctgacaggcaacgtgttgaacctc
ggggctgcgctgcctgccggctatcaccagttgacgttatcgcaaaatgataacgtctgg
ccttgccggatcatcgtcgcgccgacgcgctgttatgagccggaggcattgctggcaggg
gaaaaactgtggggcgcgacggttcagctttacacgctgcgctcggagaataactggggc
gcaggcgacttcggtgacctgaaaaaaatggtcgaagaagttgggaaacgcggcggggcg
ttcgtcgggctgaatccgatacacgcgctctatccggcgaatccgcaaagtgccagccct
tacagtccgtcgtcgcgccgctggctgaatctgacctacattgatgtgaatgccgtggag
gagtttaccgccagtcgcgaggcgcaagactggtggcattcgacagagacgcgcgaggcg
ttattgcaggcacgcagcacggagtttgtcgattatccgctggtgatggcgctgaaatcg
gcggcgctcaaactggcctggccgctgttttgcgagttgccggaagacagcccgcgtaag
caggattttcgccgtttcgtcgcacttggtggcgacagcctgcgacagcaggcgttgttc
gacgcactgcatacgcatctgcgcgatctggatttaggccagtggggctggccggtatgg
ccggaagtctatcgtgatgcgaaaagtgcacaagtgcgggaattcagcgagcgttacgcc
ggtgaaattgaattttatcagtggcagcaatggctggcgcagatgcagttttccgcatgt
tatcagcgcagtgttgagctgaagatgccgatcggcgtgtatcgtgatctggcggtcggc
gtagcgcaaggcggcgcggaaacctggtccgatccggcgctgtattgcctgaatgctacc
atcggtgcgccgccagatattctcgggccgcagggacaaaactgggggcttccgcccatt
gatccacacgaaatgaaagcccgtgcctatcagccgttcatagatttgctgcgtgcaaac
atggcggaatgcggtgcgctgcgtatcgatcacgtcatggggttgctgcgtttgtggtgg
atacccgccgaacaggaggcgggcagcggcgcgtatgtccgttatccgctggaggattta
ctcggtgtgctggctttggaaagtcagcggcatcagtgcatggtgattggtgaagacctc
ggtaccgtgccgaaagaaatcctcgccagcctgcgtgacagcggggtgtattcctacaaa
gtgttgtatttcgagcacgataaacacttcctttaccggccgccggaagattatgtttca
caagcgatggcaacggtcaccacccatgatttaccgacgttgcggggctactgggaaggg
ggcgatttaacgctcggagcgtcgctgggcgtttatcctgatccgcaggtgctggaaaaa
ctgcgcggggaacgtgaacgtagcaagcaggggcttcttaatgcgctgcatctgacacag
tgtgtgccgaaatcgatcagccgcagtgctgaaaacatgccgatgacgccgctgctgaac
ctgggtttgcaacgttatctggcgggcagtgccagcgcgttgctgggtttgcaaccggaa
gactggctggacatggatttgccggtgaatgtgccgggcaccaataccgaataccccaac
tggcggcgcaaactgacgcgaaccctggaggacatgtttgctgatgagcatattgatgcg
ctgctcagtgatttaaaccagcgcaggcaggcataa

DBGET integrated database retrieval system