KEGG   Rahnella aquatilis HX2: Q7S_02235Help
Entry
Q7S_02235         CDS       T01850                                 

Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
raa  Rahnella aquatilis HX2
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:raa00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
483626..484372
Genome map
AA seq 248 aa AA seqDB search
MLEQICQLARDAGDAIMAVYDGEQPLDARHKKDDSPVTAADIAAHNVIKAGLQTLDPQTP
MLSEEDPQSWSERQNWTRYWLVDPLDGTKEFLKRNGEFTVNIALIEDGIPVLGVVYVPVT
KVMYSAAEGKAWKEEQGERQQIAVKEAHPPLVVVSRSHFSNDPELQDYLAQLGEHQTVAI
GSSLKFCLVAEGAAQLYPRFGPTNIWDTGAGHAVALAAGAQVHDWKGQTLNYVPRESFLN
PGFRVSLF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgttagagcaaatttgtcagttagcgcgcgatgcgggtgacgcgatcatggcggtgtat
gacggtgaacaaccgcttgatgcgcgccataaaaaagacgattcgccggtcaccgcagca
gatattgcagcgcacaacgtgattaaagccggcctgcaaacgctggatccgcaaacgccg
atgctgtcggaagaagacccgcaaagctggagcgagcgtcagaactggacgcgttactgg
ctggttgatccgctggacggtaccaaagaattcctgaaacgtaacggtgaattcaccgtt
aatattgcactgatcgaagacggtatcccggtgttaggcgtggtgtacgtgccggtgacc
aaggtgatgtacagcgccgcagaaggcaaagcctggaaagaagagcagggcgaacgtcag
cagattgcagtgaaagaagcgcatccgccgctggtggtcgtcagtcgttcacacttcagt
aatgaccctgaattgcaggattacctggcgcaactgggcgaacatcagacggtagcgatc
ggctcgtcgctgaaattctgtctggtggctgaaggtgcggcacaactttatccgcgcttc
ggaccgaccaatatctgggataccggcgccggtcatgctgtcgcgctggctgccggtgcg
caggtacatgactggaaagggcagacgctgaactacgtgccacgcgaatcgttcctgaat
ccgggcttcagagtgtctttattctga

DBGET integrated database retrieval system