KEGG   Rahnella aquatilis HX2: Q7S_02395Help
Entry
Q7S_02395         CDS       T01850                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
raa  Rahnella aquatilis HX2
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:raa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
516885..517724
Genome map
AA seq 279 aa AA seqDB search
MHLTARESRLDLTYPQVMGILNVTPDSFSDGGRHNTLDLALRHAQAMVDAGATILDIGGE
STRPGAAEVSEDEELARVVPVVEAIAQRFDVWISVDTSKAAVIREAANAGMHLINDIRSL
QEPGALQAAAETGLPVCLMHMQGDPKTMQHAPHYDNVVAQVDQYFFEQIARCVNAGIAKE
KLLLDPGFGFGKNLEHNYQLLARLAEFHHFGMPLLVGMSRKSMVGQLLHVSPEKRVTGSV
ACAVIAAMQGAKIVRVHDVKETVEAMRIVEATLSARDKN
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcacctcactgccagagagtccagattggatctcacttacccccaggttatggggatc
ctgaacgttacccccgactcattttccgatggcgggcgacataacacgcttgatcttgct
ctcagacatgctcaggcaatggttgatgcaggcgcgacaattctcgacatcggtggtgaa
tcgacccgccctggtgcagcagaagtcagcgaagatgaggaactggcccgtgtggtgccg
gtagtcgaagccattgcgcagcgttttgatgtctggatctccgtcgatacctcaaaagcc
gccgtgatccgtgaagcggcaaatgcgggcatgcatctgatcaacgatatccgttcactt
caggagcccggtgcgctacaggctgcggccgaaacaggtttgcctgtttgtctgatgcac
atgcagggtgaccccaaaacgatgcagcatgccccgcattacgacaatgtcgttgcgcag
gtggatcagtatttttttgagcaaattgcccgttgtgttaacgccggcattgcgaaagag
aaattgttgctcgatccgggcttcggtttcggtaaaaatttggagcataactatcagttg
ctcgcacggttggctgagtttcatcactttggcatgccattgttagtggggatgtcgagg
aaatccatggtggggcaacttctgcatgtttctcctgagaaacgggttaccggaagtgtt
gcttgtgctgtgatcgctgccatgcaaggtgctaagatcgtgcgtgtacatgatgtaaaa
gaaaccgttgaagcgatgcgtatcgtggaagcgacactttctgcaagggataaaaactaa

DBGET integrated database retrieval system