KEGG   Rahnella aquatilis HX2: Q7S_03610Help
Entry
Q7S_03610         CDS       T01850                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
raa  Rahnella aquatilis HX2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Q7S_03610
   01230 Biosynthesis of amino acids
    Q7S_03610
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q7S_03610
   00030 Pentose phosphate pathway
    Q7S_03610
   00051 Fructose and mannose metabolism
    Q7S_03610
   00052 Galactose metabolism
    Q7S_03610
  Energy metabolism
   00680 Methane metabolism
    Q7S_03610
Enzymes [BR:raa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Q7S_03610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(787651..788595)
Genome map
AA seq 314 aa AA seqDB search
MTKIVTLTLAPSLDSATLTPKIYPEGKLRCTAPVFEPGGGGINVARAIVYLGGQATALFP
TGGPTGAHLVQLLRDEGITTDTLETQDWTRQNLHVHTENTGEQYRFVMPGARLTEAEFAG
LSAKIEKIPAGSILVISGSLPPGTHITTLTELIRKAQKAGLRCILDSSGDALAAGLKLGG
LALVKPNQNELAALVGHSLENPGDVLAAAQQIIRDGGAERVVVSLGPQGALAVDANSSFQ
VVPPPVKKMSTVGAGDSMVGAMTLKLAEGADLLDMVRFGVAAGSAATLNIGTRLCSDKDT
QQIYQYLCQQTPAH
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaatagtcacactcacactggcaccttcgctcgacagtgccactctcacccct
aagatttacccggaaggtaaattgcgttgtacggcccccgtgttcgaacccggcggcgga
ggtatcaatgtagcgcgtgccattgtttatctgggcggccaggctaccgcattatttccg
acgggaggcccgacaggtgcacatctggttcagttgctgcgcgacgaggggatcaccaca
gacacgctggaaacccaggactggacccgccagaacctgcacgttcacaccgaaaatacc
ggcgaacagtatcgtttcgtgatgccgggcgcacgacttacggaggctgaattcgcgggc
cttagcgcgaaaatcgaaaagatccctgccggctcaatactggtcatcagcggcagtttg
ccaccgggcacgcacattacgacactgacagagttaatcaggaaagcgcagaaagccggt
ttacgctgcattcttgacagttcgggtgatgcactggccgcgggcctgaagctcggcggg
ctggcgctggtcaaaccgaaccagaatgaactggccgcgctggtcgggcattctctggaa
aatccgggggatgttctggctgcagctcagcaaattatccgtgacggtggtgctgaacgc
gtggtcgtttcactggggccgcagggtgcgctggccgttgacgcgaacagctcattccag
gttgtcccaccgccggtgaaaaaaatgagtaccgttggcgcaggtgacagcatggtcggc
gcgatgaccctcaaactggccgaaggggctgatttactcgacatggttcgctttggcgtg
gccgccggtagcgcggcaacactcaatatcggtacgcgtctgtgctcggataaagatact
cagcaaatttatcagtatctgtgccagcaaacaccggctcattag

DBGET integrated database retrieval system