KEGG   Rahnella aquatilis HX2: Q7S_03645Help
Entry
Q7S_03645         CDS       T01850                                 

Definition
protein disulfide isomerase II DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
raa  Rahnella aquatilis HX2
Brite
Enzymes [BR:raa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Q7S_03645
Secretion system [BR:raa02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Q7S_03645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
792977..793696
Genome map
AA seq 239 aa AA seqDB search
MKKGLMLLTLLAACMSSAVHADEAAIKATLGKLGMSHADIQPSPVTGLSAVSTDSGTLYI
TDDGKHVLQGPLYDVSGSHPVNVTNKALVKKMDALQNEMIIYKAKNEKHVITVFTDITCG
YCHKLHQQIQDYNDLGITIRYLAFPRQGLNSKTEKDMQSIWCTGNRKTNFDAAMRGDDIT
PATCKTSDIAKQFELGVQFGVTGTPAIVLADGTLIPGYQPPKEMAAMLDQQDPSHKTGG
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtttaatgctgctgacacttctggctgcgtgtatgagctccgcggtccat
gctgatgaagcagcaatcaaagccacgctgggcaaactgggcatgagccatgccgacatc
cagccttcgccggtaaccggcctgagtgcggtttctaccgacagcggcaccctttacatt
accgacgacggcaaacacgttttgcaaggcccgctgtatgacgtcagcggcagccatccg
gttaacgtcaccaacaaagcgctggtgaagaagatggatgcgttacaaaacgagatgatc
atttataaagccaaaaacgaaaagcatgtgatcacggtgtttaccgatatcacctgcggt
tattgccacaagctgcatcagcagatacaggactataacgatcttggcataaccatccgt
tatctggccttcccgcgtcaggggctgaattccaaaaccgagaaagacatgcaatctatc
tggtgtacaggcaaccgcaaaaccaactttgatgcggcaatgcgcggcgatgacatcacg
ccggcaacctgtaaaaccagtgatattgcgaagcaatttgagctgggcgttcagttcggc
gtgacaggcactccggccatcgtgctggcagacggaactttgatccctggttatcagccg
ccgaaagaaatggctgccatgctcgaccagcaggatccttcacataaaaccggtggttga

DBGET integrated database retrieval system