KEGG   Rahnella aquatilis HX2: Q7S_04085Help
Entry
Q7S_04085         CDS       T01850                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00900  Terpenoid backbone biosynthesis
raa01100  Metabolic pathways
raa01110  Biosynthesis of secondary metabolites
raa01130  Biosynthesis of antibiotics
Module
raa_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Q7S_04085
Enzymes [BR:raa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Q7S_04085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: AFE57073
UniProt: H8NMQ2
Position
891910..893106
Genome map
AA seq 398 aa AA seqDB search
MKQMTILGSTGSVGTSTLSVVRSNPDDFAVKALVAGRNVDVMAQQCLEFHPAYASMADES
SARALRAILAEQGSRTEVLSGPDAATELAALDDVDQVMSAIVGAAGLLPTLAAVRAGKKV
LLANKESLVTCGRIFMDAVRHSQSQLLPIDSEHNAIFQSLPESIQKQLGYASLESHGISR
IILTGSGGPFRELPLDKFRDVTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASAAEMEVIIHPQSVIHSMVRYCDGSVLAQLGSPDMRTPIAHAMAYPHRVRTDVEALDFC
KMGAMTFSAPDYARYPCLQLAIEASNTGQAATTALNAANEISVAAFLNGEIRFTDIAGLN
RQVMEQLVSAEPDSVEEVLEIDAQARASAREKLHTFAL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaatgactattcttggttcgacagggtctgtcggcaccagcacgctttccgtt
gtccggtctaaccctgacgatttcgccgttaaagcactggttgcagggcgcaatgttgac
gttatggcgcagcagtgtcttgagtttcaccctgcctatgcttcgatggcggatgaatct
tctgcccgtgcgctgagagccattctggctgaacagggaagccgtaccgaggtgctttcc
ggacccgatgcggcgactgaactggccgctcttgatgatgtggatcaggtgatgtcggct
atcgtgggggctgcgggcttgttaccgacactcgctgctgtccgcgccggtaaaaaggta
cttctggctaacaaagaatcgctggtgacctgcgggcgcatttttatggacgctgtccgc
catagtcagtctcagctattgcctatcgacagtgaacataacgctattttccagagtttg
cctgaatccattcaaaaacagctgggatatgcttccctcgaaagccacgggatctcccgc
attattttaaccggatccggtggcccgttccgcgaactgccgttggataaatttcgcgat
gtcactcctgatcaggcttgcgcgcatcccaactggtcgatggggcgtaaaatttccgtc
gactcggcaaccatgatgaataaagggctggagtatattgaagcccgctggttgtttaat
gcctctgctgctgagatggaagtgattatccatccgcaatccgtgatccattccatggtg
cgttattgcgatggcagcgtgctggctcaacttggctcgccggatatgcgtaccccaatt
gcgcatgccatggcatatccgcacagagtcagaactgacgtcgaagcgttggatttttgt
aaaatgggtgcgatgactttcagtgcaccggattacgcacgttatccttgtttgcaattg
gctatcgaagccagcaacaccgggcaggcagcgacgacggcactgaatgccgcgaatgaa
atttcggtggccgcgttcctcaatggtgagattcgttttactgacattgctggcctgaat
cgtcaggtgatggagcagttagtgagcgctgaacctgattctgttgaggaagtgttggag
atcgacgcgcaggcgagagccagtgcacgtgagaaacttcatacatttgcgctataa

DBGET integrated database retrieval system