KEGG   Rahnella aquatilis HX2: Q7S_04485Help
Entry
Q7S_04485         CDS       T01850                                 

Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
raa  Rahnella aquatilis HX2
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Q7S_04485
Enzymes [BR:raa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Q7S_04485
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Q7S_04485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
974656..975201
Genome map
AA seq 181 aa AA seqDB search
MSALTIFSDQDPSAPLWESRDGDAIAAELSKIDVRFERWQADRDLGENPQPQDVIAAYQH
EIDKLVEEKGYQSWDVISMRPDNEQREVLRTKFLSEHTHGEDEVRFFVEGAGLFCLHLNG
KIFQILCEKNDLISVPANTRHWFDMGGSPSFTAIRVFDNPEGWVAHFTGDKIADAYPRMG
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcattaacgatttttagtgaccaggatccttccgcaccgttgtgggaaagccgt
gacggggacgcgatcgctgctgagctgagcaaaattgatgtgcgtttcgaacgctggcag
gctgaccgcgatttaggcgagaacccgcagccgcaggacgtgattgccgcctatcagcat
gaaatcgacaaactggtcgaagagaagggctatcagagctgggatgtgatcagcatgcgc
ccggacaacgaacagcgtgaggtgctgcgcaccaaatttctctctgaacatacacatggc
gaagacgaagtgcgtttcttcgtcgaaggcgcggggctgttttgcctgcatctgaacggc
aagatttttcagatcctgtgcgagaaaaacgatctgatttccgtaccggctaatacccgc
cactggtttgacatgggcggatccccgtcatttaccgcgatccgtgtattcgataatccg
gaaggctgggtagcgcatttcaccggcgataagattgcggatgcgtatccgcggatgggg
gagtaa

DBGET integrated database retrieval system