KEGG   Rahnella aquatilis HX2: Q7S_04485Help
Entry
Q7S_04485         CDS       T01850                                 

Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
raa  Rahnella aquatilis HX2
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:raa00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
974656..975201
Genome map
AA seq 181 aa AA seqDB search
MSALTIFSDQDPSAPLWESRDGDAIAAELSKIDVRFERWQADRDLGENPQPQDVIAAYQH
EIDKLVEEKGYQSWDVISMRPDNEQREVLRTKFLSEHTHGEDEVRFFVEGAGLFCLHLNG
KIFQILCEKNDLISVPANTRHWFDMGGSPSFTAIRVFDNPEGWVAHFTGDKIADAYPRMG
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcattaacgatttttagtgaccaggatccttccgcaccgttgtgggaaagccgt
gacggggacgcgatcgctgctgagctgagcaaaattgatgtgcgtttcgaacgctggcag
gctgaccgcgatttaggcgagaacccgcagccgcaggacgtgattgccgcctatcagcat
gaaatcgacaaactggtcgaagagaagggctatcagagctgggatgtgatcagcatgcgc
ccggacaacgaacagcgtgaggtgctgcgcaccaaatttctctctgaacatacacatggc
gaagacgaagtgcgtttcttcgtcgaaggcgcggggctgttttgcctgcatctgaacggc
aagatttttcagatcctgtgcgagaaaaacgatctgatttccgtaccggctaatacccgc
cactggtttgacatgggcggatccccgtcatttaccgcgatccgtgtattcgataatccg
gaaggctgggtagcgcatttcaccggcgataagattgcggatgcgtatccgcggatgggg
gagtaa

DBGET integrated database retrieval system