KEGG   Rahnella aquatilis HX2: Q7S_04675Help
Entry
Q7S_04675         CDS       T01850                                 

Definition
xylose isomerase domain-containing protein TIM barrel
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
raa  Rahnella aquatilis HX2
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Q7S_04675
   00051 Fructose and mannose metabolism
    Q7S_04675
Enzymes [BR:raa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Q7S_04675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1010846..1011739
Genome map
AA seq 297 aa AA seqDB search
MLQMIERAATVKGLTHLDLNYPQHMTGDITLMRQKIEEVGLAVNGMQMRWDAPEFKIGAF
THPDPKIRRQAIELTKRGIDAGREFGASIMTLWMGQDGFDYCFQADYKKIWEDAVSAVRE
VAEYAPDIDVSIEYKPNEPRAYSIFPNATTCLLAVEEAGCKNLGITLDFAHVLFANEVPA
FAAAMVARRSRLLGLDLNDGWGKRDDGLMVGSVNPRATLEFLLQMKRDGYKGAYYFDTFP
DASGLDPVREAETNIATVIRLLKLCEKLENNPALNEAISRQDAVATQQIVNDVMLAQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcaaatgatcgaacgtgcagctacggttaaaggattgacgcatctggacctgaat
tatccgcagcacatgaccggcgatatcactttgatgcgccagaaaatcgaagaagtcggg
ctggcggtgaacgggatgcaaatgcgctgggatgctccggaatttaaaatcggcgcattt
actcacccggatccaaaaattcgtcgtcaggcgattgaattgaccaaacgcgggatcgac
gccggtcgtgagtttggtgctagcattatgacgttgtggatgggacaggatggctttgat
tactgtttccaggctgactacaaaaaaatctgggaagacgcagtcagcgctgtgcgtgaa
gtggcggaatacgccccggatatcgacgtcagcattgaatacaaacccaacgaaccacgc
gcttacagcattttcccaaatgccactacctgtctgctggcggttgaagaagccggttgc
aagaacttaggtatcacactggatttcgcgcatgtgttgtttgccaacgaagtaccggcg
tttgcggcggcgatggtagcccgtcgttcgcgtttgctggggctcgatctcaatgacggc
tggggcaaacgcgacgacggcctgatggtcggctccgtcaacccgcgtgccacgctggaa
ttcctgttgcagatgaaacgcgacggctataaaggcgcgtattacttcgataccttcccg
gacgccagcggattggatccggtgcgtgaagcagaaaccaatatcgcgaccgtgatccgt
ttactcaaactttgcgaaaaactcgagaataacccggcgctgaatgaagccatcagcagg
caggacgccgtagccacacagcaaatcgtcaacgacgtgatgttggcgcagtaa

DBGET integrated database retrieval system