KEGG   Rahnella aquatilis HX2: Q7S_04700Help
Entry
Q7S_04700         CDS       T01850                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
raa  Rahnella aquatilis HX2
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Q7S_04700
Enzymes [BR:raa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Q7S_04700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1016252..1017112
Genome map
AA seq 286 aa AA seqDB search
MGKILVTGSLHYDIVIHAHHRPEKGETVIGSGCSYKFGGKGGNQAVAAARAGAGVRFAGA
VGADTQGEFLRGVLNENAVDSSFIAVNESVPSGMSVALMDAEGDYGAVVVSNANNHIDAA
QFDDDALWQQVDMLLLQNEVPEAVNLAAAKQAKQRGIRVCLNAAPARTLCAEMQSAVDLL
VVNGVEARDLSGIPVNDLSDACVAAELLSQHSPAVIVTAGEHGVAWCAAGGRSQSMPAEK
IELVSTHGAGDCFMGTLCTSLLQGKTLADSVAKANRAAAEHVSRKA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaattttagtcacgggcagccttcattatgacatcgtgatccacgcgcatcat
cgtccggaaaaaggcgaaacggtgatcggcagcggatgttcatataaattcggcggcaag
ggcgggaatcaggccgttgccgctgccagagcgggcgccggtgttcgttttgccggtgcc
gtgggcgccgatacgcagggggaattcctgcgtggtgtgctaaatgaaaacgcggtcgac
agcagctttatcgccgttaatgaaagcgtaccttccggcatgagcgtggcgctgatggat
gcagaaggggattacggcgcagtggtcgtttccaatgcaaacaaccacattgatgccgcg
cagtttgatgatgatgccttgtggcagcaggttgacatgctgttgttacaaaatgaggtg
ccggaggcggtgaatctggcggcagcgaaacaggcgaaacagcgcgggatccgcgtttgt
ctgaatgccgcaccggcgcggacactttgtgctgagatgcagtctgctgtcgatttgctg
gtggtgaatggcgtcgaagcccgtgatctgagcggtattccggtcaatgatttgtccgat
gcctgcgtggcagccgaattactgagccagcattctccggctgttatcgtgacggcgggt
gaacacggtgtggcctggtgtgcagccggcggacgcagccagtcgatgcccgccgaaaaa
atagagctggtcagtacccacggtgccggtgactgctttatgggcacgttgtgcacatca
ctcttgcaagggaaaacgctggcagattccgtcgcaaaagccaaccgtgcagccgccgaa
cacgtctcccgcaaagcctga

DBGET integrated database retrieval system