KEGG   Rahnella aquatilis HX2: Q7S_04735Help
Entry
Q7S_04735         CDS       T01850                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
raa  Rahnella aquatilis HX2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:raa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Q7S_04735
Enzymes [BR:raa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Q7S_04735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1026097..1028151
Genome map
AA seq 684 aa AA seqDB search
MRINSREDIAQLLASWVECGWLRELDRALVTFLAKEAPDAHPLLLLATALTSYQLGRGHV
CLDLQATLDDSAFSLSLPPEGDHADGAVIRPAAVLDDLSLQEWLAALVHPTLVGHHEGNS
PLVLTGQRLYLRRYWQYEQNVRAAIEQRLARSALHTLPVESLRAPLTALFPADAKSDIAN
WQKLACALAAGSAFSIITGGPGTGKTTTVVRLLALLQTLALEENGQPLRIRLAAPTGKAA
ARLNESIAGAVSKLDLSALGNGNAVRESINTDVVTLHRLLGSRPDTRHFRHHPGNPLMLD
VLVVDEASMVDLEMMAALLAALPEQARLILLGDKDQLASVEAGALLSELCQRANGGHYLP
HTRDWLQSVTGEQVPDSLVDPQGTAMDQAVVMLRHSYRFDAQSGIGQLAEAVNDGDVKAL
KQVWKHGYADLAQLTLSTDDDAELRDWVVKGGTKQFPAAARREGVEPPVGYQHYLNVMIQ
ARPADNEPPEAFNRWAARVLLAYSQFQLLCALRGGRWGVEELNQRIADILRKEGLLKASI
GWYPGRPVLVTRNDYSQRLMNGDIGITLEIPHRLADGTVVPTLRVAFLAGDGTQDIRWVM
PGRLQAVETVFAMTVHKSQGSEFTHTALLLPENLSPILTRELIYTGITRARHWFSLGCVG
GMNAVLPDAVKRRVLRASGLIESA
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcaacagccgtgaagatatcgcacaactgctggcgagctgggtggaatgtggc
tggctgcgcgaactcgatcgcgcactggtgacgtttctggcaaaagaagcgccggacgcg
catccgttattgttgctggcgaccgcactgaccagctatcagttagggcgcggtcatgtg
tgtctggatttgcaggccacgcttgatgacagcgcattctcactctcgctgccaccggaa
ggcgatcacgctgacggcgcggtgatccgtccggcggccgtgctcgacgacctgagtttg
caggaatggctggcggcgctggtgcacccgacgctggtcggacaccacgaaggtaattcg
ccgctggtgctgaccggccagcgcctgtatctgcgccgttactggcagtacgaacagaat
gtgcgggcggcaattgaacaacgtctggcgcgcagtgcgctgcacactttgccggtggaa
tctttgcgtgcgccgctgacggcgttattcccggcggatgcgaaatctgatatcgccaac
tggcagaaactggcctgcgcgctggcggcgggcagtgcgttcagcattattaccggcggg
ccgggcaccggtaaaaccaccacggtggtgcgtctgctggcgttgttacagacgctggcg
ctggaggaaaatggtcagccactgcgcatcagactggccgcgccgaccggcaaggcggca
gcaagactcaatgaatcaattgccggtgcggtatcgaagctggatctcagtgcgctcggc
aacggtaatgcggtgcgagaaagtatcaacaccgatgtggtgacactgcaccgtctgctc
ggcagccgcccggatacgcggcattttcgccatcatccgggcaacccgctgatgctggat
gtgctggtggttgatgaagcgtcaatggtcgatctggaaatgatggccgcattgctggcg
gcattgccggaacaggcgcgtctgatcctgctcggcgacaaagatcaactggcgtcggtg
gaagcgggggcattactgagcgagttatgtcagcgcgccaacggcggccattatctgccg
catacccgcgactggttgcaaagcgtgaccggcgaacaggtcccggattcgctggttgat
ccccagggtacggcgatggatcaggctgtagtgatgctgcgccacagttaccgttttgat
gcacaaagcggcattggtcagttagcggaagcagtaaatgacggggatgtgaaagcgctg
aaacaggtctggaaacatggatacgctgacctggcgcaactgacattgagcactgacgat
gatgctgaactgcgcgactgggtggtgaagggcggcacgaagcagttcccggcggcggcc
agacgcgaaggcgtagaacctccggtcggctatcaacattatctcaacgtgatgatccag
gcgcgaccggcagacaatgaaccgccggaagccttcaaccgctgggcggccagagtgctt
ctggcctacagccagttccagctgctgtgcgccttacgtggcgggcgctggggtgtggaa
gaactgaatcagcgcatcgccgacatcttgcgaaaggaagggttgcttaaggcgtcgatc
ggctggtatccggggcgtccggtgctggtgacccgcaatgattacagccagcgtctgatg
aacggcgatatcggcatcacgctggagatcccgcatcgtcttgccgatggtactgtggtg
ccgaccctgcgagtggcgtttctggccggagacggtacgcaggatatccgctgggtgatg
ccggggcgtttgcaggcggtggaaaccgtatttgccatgacggtgcacaaatcacaggga
tccgaatttacccataccgcgctgctgctgccggagaatctcagtccgatcctcacgcgc
gagctgatttacaccggcattacccgtgcgcgtcactggttcagtctgggatgtgtcggg
ggaatgaatgccgttttaccggatgcggtgaagcgtcgggtgttacgtgccagcggatta
atcgaaagcgcgtaa

DBGET integrated database retrieval system