KEGG   Rahnella aquatilis HX2: Q7S_05435Help
Entry
Q7S_05435         CDS       T01850                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
raa  Rahnella aquatilis HX2
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Q7S_05435 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q7S_05435 (glk)
   00052 Galactose metabolism
    Q7S_05435 (glk)
   00500 Starch and sucrose metabolism
    Q7S_05435 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Q7S_05435 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Q7S_05435 (glk)
   00524 Butirosin and neomycin biosynthesis
    Q7S_05435 (glk)
Enzymes [BR:raa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Q7S_05435 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1176453..1177424
Genome map
AA seq 323 aa AA seqDB search
MTKYSLVGDVGGTNCRLALCALDSGDISQSKTFSGLDYDSLEAVVREYLAQQHQDVEDAC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGLQHLEVINDFTAVSMAIPMLKEDDLLQFG
GKKAQDGKPAVIYGAGTGLGVAHLIHANNQWLSLPGEGGHVDFAPNSEEEDIILEQLRTE
MGHVSAERILSGPGLVNLYRAIVKSDNRVPENFKPKDVTELALADENLDCRRALSLFCVI
MGRFGGNLALNMGTFGGVYIAGGIVPRFLDFFKASGFRAAFEDKGRFKDYLMDIPVFLIT
HDQPGLVGAGAYLRQSIGLPLRP
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatactccctggtgggcgatgtcgggggcaccaactgccgcctggcgctttgc
gcgttggacagcggcgatatttctcagtctaagactttctccgggctggattacgacagc
ctcgaagccgtggtgcgtgagtacctcgcgcagcagcatcaggatgttgaggatgcatgt
attgccatcgcctgcccgatcactggcgactgggtggccatgaccaaccatacgtgggcc
ttttccattgccgaaatgaagaaaaaccttggcctgcaacatctggaagtgatcaatgac
ttcaccgccgtttcgatggcgatcccgatgctgaaagaagatgacctgttgcagttcggc
ggtaaaaaagcgcaggacggcaaaccggcagtgatttacggtgctggcacggggctgggc
gtcgcacacttaattcatgccaataaccaatggttgagtctgccgggcgaaggcggccat
gttgatttcgcgccaaacagcgaagaagaagacatcattcttgagcagttgcgtaccgaa
atggggcacgtttctgccgagcgtattctctccggtccggggctggtgaatctctaccgt
gccattgttaaatcagataaccgcgtgccggaaaacttcaaaccgaaagacgtgacagaa
ctggcgctggcagacgaaaatctggattgccgccgcgcactgtcgctgttctgcgtcatc
atggggcgtttcggtggcaacctggcgctgaacatggggaccttcggcggcgtgtacatt
gccggcggcattgttccgcgcttcctggacttcttcaaagcttccggttttcgtgccgcg
tttgaagacaaaggccgcttcaaagattacctgatggatattccggtgttcctgatcacg
cacgatcagccggggcttgtgggtgccggggcgtacctgcgtcagtctatcggccttcct
cttcgtccttga

DBGET integrated database retrieval system