KEGG   Rahnella aquatilis HX2: Q7S_07160Help
Entry
Q7S_07160         CDS       T01850                                 

Definition
(RefSeq) putative lysozyme from lambdoid prophage DLP12
  KO
K01185  
lysozyme [EC:3.2.1.17]
Organism
raa  Rahnella aquatilis HX2
Brite
Enzymes [BR:raa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Q7S_07160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1573168..1573677
Genome map
AA seq 169 aa AA seqDB search
MNSIVKRCSVAVVLALAALMPDYRFVKTSAEGLAIIANLEGCRLNPYQCSAGVWTSGIGH
TAGVKPAQNITQQDAARNLIADIIMTERAVDKCMPVTMPQPVYDAVISLAFNVGTGAACK
STLAYFIRHGEWSQACQQLPRWVYVNGVWNKGLKNRRAVELKHCMKGVP
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaatcgttaaacgttgcagtgtggccgtcgtgttggcactcgccgcgctgatg
cctgattaccggtttgtcaaaacctccgccgaggggctggccattatcgccaacctcgaa
gggtgccgcctgaatccgtaccagtgcagtgccggagtctggacatctggcatcggccac
actgcgggggtgaagcccgcgcagaacattacgcagcaggacgccgcccgtaatctgatt
gctgacatcatcatgacggagcgcgccgtggataaatgcatgccggtgaccatgccgcag
ccggtgtatgacgccgtgatcagtctggcgtttaacgtcggcacgggggcagcgtgtaaa
tccacgctggcctatttcatcaggcacggtgaatggtcacaagcctgccagcagctcccc
cgctgggtgtacgtcaatggcgtgtggaataaggggctcaagaaccgccgggcggttgag
ctgaaacactgcatgaagggggtgccatga

DBGET integrated database retrieval system