KEGG   Rahnella aquatilis HX2: Q7S_07690Help
Entry
Q7S_07690         CDS       T01850                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
raa  Rahnella aquatilis HX2
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Q7S_07690
Enzymes [BR:raa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Q7S_07690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1693597..1695666
Genome map
AA seq 689 aa AA seqDB search
MTKFPLLSSKISGLLHGADYNPEQWLESPDVLIRDVEMMKEARCNVMSVGIFSWSALEPE
EGHFTFGWLDQVLDKLHENGISVFLATPSGARPAWMSQKYPEVLRVGRDRVKALHGGRHN
HCMSSPVYAEKVQLMNSALAKRYAHHPAVIGWHISNEYGGECHCHYCQTRFRDWLKARYV
TLDALNQAWWSTFWSHTYTDWAQIESPSPQGESGIHGLNLDWRRFNTDQVTRFCSEEIRP
LKAENPALPATTNFMEYFYDYDYWKLASVLDFISWDSYPMWHTRKDDIGLAAYTAMYHDL
MRTLKQGQPFVLMESTPSFTNWQPVSKLKKPGMHILSSLQAVAHGSDSVQYFQWRKSRGS
SEKFHGAVVDHVGHIDTRVGREVAELGGILSALAPVAGSRVEARVAIIFDWESRWAMDDS
LGPRNQGLEYENTVAGHYRALWSQGIAVDVINADCDLTGYDLVIAPMLYMVRAGVGERIT
AFVQAGGRFVATYWSGIVNESDLCFLNGFPGPLRPVLGIWAEEIDSLTDDQHNSVSGTEG
NALGLNGPYRASELCEVIHLEGAAALATYGDDFYAGTPAVTVNLFGKGQAYYLASRNDQQ
FHADFYTALAKEMKLPRAIATDLPEGVTAARRTDGESEFIFLQNYAADSQTVTLPDDYRD
MVHGGILPRTLTLPAFGCQILSRRLSVIS
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaatttcctcttctgagcagtaagatttccgggctattacatggtgcggattac
aacccggaacagtggctggaaagccccgatgtgctgattcgcgatgtcgaaatgatgaaa
gaggcgcgctgtaatgtcatgtcagtcgggattttcagctggtcagcgctggagcctgaa
gaaggtcattttacctttggctggctggatcaggtgctggacaagttgcatgaaaatggc
atctcggtatttcttgccacaccaagcggcgcacgtccggcgtggatgtcgcaaaagtat
cctgaagtcctgcgcgtcgggcgtgaccgcgtaaaagcactgcacggcgggcgtcacaat
cactgtatgagttcgccggtgtatgccgaaaaagtgcaactgatgaacagtgcgctggcg
aagcgttacgcccatcatccggcggtgattggctggcatatttccaacgaatacggcggc
gagtgccattgccattactgccagacccgtttccgcgactggttgaaagcccgttacgtc
acgctcgatgcgctgaatcaagcctggtggagcactttctggagccacacctataccgac
tgggcgcagatcgaatcgccgtcgccgcagggcgaaagcggcattcacggcctgaatctc
gactggcgtcgttttaacaccgatcaggtcacgcgtttttgcagcgaggaaatccgcccg
ctcaaagcggagaatccggcgttaccggcgaccaccaatttcatggagtatttctacgat
tacgattactggaaactcgccagcgtgctggatttcatctcgtgggacagctatccgatg
tggcatacccgcaaagatgatatcggtctggcggcatacactgcgatgtatcacgattta
atgcggacgctgaaacagggacagccgtttgtgctgatggaatcgacaccgagtttcacc
aactggcagccggtcagcaaactgaaaaagccgggcatgcatattctgtcttctttgcag
gcggtcgctcatggttcggattctgtgcagtatttccagtggcgtaaaagccgcggttcg
tcagaaaaattccacggcgcggtcgtcgatcacgtcgggcatatcgatacccgtgtcggg
cgcgaagtggccgaactgggcgggattctatcggcgctggctccggtggcgggcagccgc
gtagaagccagagtggcaattatcttcgactgggaaagccgctgggcgatggacgattcc
ctcggaccgcgcaatcagggactggaatatgaaaacacggttgccggacattaccgcgca
ctgtggtcgcagggcattgcggtcgatgtgatcaatgccgattgcgatttaaccggttac
gacctggtgattgcgccgatgctgtatatggtgagggcaggcgtcggcgagcggatcacc
gcgttcgtgcaggccggcgggcggttcgtcgcgacttactggagcggtatcgttaacgaa
agcgatttgtgtttcctcaacggattccctggaccgttgcgtccggtactgggtatctgg
gcggaagaaatcgacagcctgaccgacgatcagcacaacagcgtcagcggcactgaaggc
aatgcgctggggttaaacggcccgtatcgtgccagcgaattgtgtgaagtgatccacctg
gaaggtgcggccgcactggcgacgtacggtgacgatttctacgccggcacgcccgccgtg
accgtgaatctgtttggcaaagggcaggcgtattatctggcttcccgaaacgatcagcaa
ttccacgccgatttttataccgcgctggcgaaagaaatgaagctgccacgggcgatagcc
accgatctgcctgaaggtgtcactgccgcacgacgcaccgacggtgaaagtgaatttatc
ttcctgcaaaactatgccgccgacagccagacggtgacattgccggatgattaccgcgat
atggttcacggcggtatattaccgcgcacactgacgcttccggcattcggttgtcagatc
ctgtcgcggcgtttatctgttatttcttaa

DBGET integrated database retrieval system