KEGG   Rahnella aquatilis HX2: Q7S_07970Help
Entry
Q7S_07970         CDS       T01850                                 

Definition
peroxiredoxin
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
raa  Rahnella aquatilis HX2
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:raa00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:raa00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1749347..1749829
Genome map
AA seq 160 aa AA seqDB search
MITFHQLTATSLDGQLISMADYAGKLVLVVNTASHCGFTPQYAGLEALYKKYAAQGLVVL
GFPCNQFGKQEPGGADEIAQTCHINYGVSFPIFEKVEVNGAATHPVFRYLKNELPGVLGG
RIKWNFTKFLIGRDGKPLKRFAPFTTPEKMETVILAALEI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgatcacctttcatcaactcaccgccaccagtctggatggccagctcatctctatggcc
gactatgcgggtaagctggttctggtggtgaataccgccagccattgtggcttcacgcca
caatacgcaggccttgaagcgctctacaagaagtacgctgcacagggtctggtggtgctt
ggttttccctgcaaccagttcggtaagcaggaacccggcggcgccgacgaaatcgcgcag
acctgtcacatcaactatggtgtgagcttcccgatattcgaaaaagtggaggtcaacggc
gctgctacgcacccggtgtttaggtatctgaaaaacgaattgcccggtgtactcggtggg
cggatcaagtggaacttcactaagttcctgatcggacgcgacggcaaaccgctcaagcgt
tttgcaccgttcaccaccccggagaaaatggaaaccgtaatacttgctgcacttgaaatc
taa

DBGET integrated database retrieval system