KEGG   Rahnella aquatilis HX2: Q7S_08370Help
Entry
Q7S_08370         CDS       T01850                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
raa  Rahnella aquatilis HX2
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:raa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1832774..1833388
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGIILEKQPPLVLLETNGVGYEVHMPMTCFYELPELGQEAIIFTQFIVREDAQLL
YGFNDKQERALFRELIKVNGVGPKLALAILSGMSAQQFVSAVEKEEITALIKLPGVGKKT
AERLVVEMKDRFKGLNGDLFNNHTDITLPASASKAKESDAEGEAVAALISLGYKPPEASR
MISKVAKPGAESETLIREALRAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactacgaggcattattctggaaaaacagccccctttggtgctgcttgaa
accaacggcgtgggctatgaagtgcatatgccgatgacctgtttttatgaattgccggaa
ctgggtcaggaagctatcatcttcacgcaatttatcgtccgtgaagatgcccagttgctc
tacggatttaacgataaacaagagcgcgcgctgttccgcgagctgattaaagtcaacggc
gttgggccgaagctggcgctggcgattctgtcaggcatgtcggcgcagcagtttgtcagt
gcggtagaaaaggaagaaatcaccgcattaattaagttacctggcgtcggtaagaaaacc
gcagaacgcctggtcgtcgaaatgaaagaccggtttaaaggattaaacggtgatctattt
aacaatcatactgatatcacgctacctgcatcggcgtcgaaagctaaagaatctgacgcc
gaaggcgaagccgttgcagcgctgatatccctcggatataaaccaccggaagccagccgc
atgatcagcaaggtggccaaaccgggcgcagaatctgaaacgttgattagagaagcgctg
cgcgcagcgctgtga

DBGET integrated database retrieval system