KEGG   Rahnella aquatilis HX2: Q7S_08520Help
Entry
Q7S_08520         CDS       T01850                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
raa  Rahnella aquatilis HX2
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:raa00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:raa00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:raa00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:raa00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1869437..1870324
Genome map
AA seq 295 aa AA seqDB search
MLKAVIPVAGLGTRMLPATKAIPKEMLPIVDKPLIQYIVNECAAAGIKEIILVTHSSKNA
IENHFDTSFELESMLESRVKRQLLEEVQSICPKGVTIMNVRQGQSKGLGHAVLCAKPLIG
NSPFAVILPDVLMDDSTSDLRKDNLAAMLRRFQETGNSQVMVEEVPEKDVSKYGIVNCNG
VEVEPGESAPMTAIVEKPELKDAPSNLAVVGRYVLSEAIWPLLAVTPYGAGNEIQLTDAI
AMLMKKHTVEAFSMTGRSHDCGDKLGYMKAFVEYGIRHNTQGEAFKAWLKEFAEE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagctgttatccctgttgccggtctgggcacacgtatgttgccagcgacgaaa
gccattccaaaagaaatgctgcctatcgtcgataagcctttgatccagtacatcgttaat
gaatgtgctgcggcgggcatcaaagaaatcattctggtcacgcactcttcgaaaaacgcg
atcgaaaaccacttcgatacctctttcgagctggaaagtatgcttgaatcccgtgtgaaa
cgtcagctgctggaagaagtgcagtctatctgcccgaaaggcgtgaccatcatgaacgta
cgtcaggggcaatcaaaaggccttgggcatgcggttctgtgtgcaaaacctctgattggt
aattctcctttcgcggttattctgccagacgttttgatggatgattccaccagcgatctg
cgtaaagataaccttgctgccatgcttcgtcgcttccaggaaactggcaacagtcaggtc
atggttgaagaagtaccggagaaagacgtttccaagtacggtattgttaactgcaacggc
gtagaagttgaaccgggcgaaagcgcgccaatgacggctatcgttgaaaagccggaactg
aaggacgcgccatcaaacctcgcggttgtcggccgttatgttctgtccgaagctatctgg
ccactgctggcagtcacaccgtatggtgcaggtaatgaaattcagctgactgatgccatt
gccatgctgatgaaaaaacatactgttgaagccttctccatgactggccgttcacatgac
tgtggtgataagctcggttatatgaaggcgtttgttgagtacggtattcgccataacacg
cagggcgaagcgttcaaggcatggttgaaagagtttgctgaagagtaa

DBGET integrated database retrieval system