KEGG   Rahnella aquatilis HX2: Q7S_08555Help
Entry
Q7S_08555         CDS       T01850                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
raa  Rahnella aquatilis HX2
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Q7S_08555
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Q7S_08555
Enzymes [BR:raa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Q7S_08555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1876985..1877524
Genome map
AA seq 179 aa AA seqDB search
MNVIDTDVLGVKLVEPKVFGDDRGFFLETFQQDRYKKMLNIDLDFVQDNHSRSSQNVLRG
LHFQTCKPQGKLVRVVRGEVFDVVVDIRPESETFGKWVGVHLSETNKNQLWVPPGLAHGF
VVISDFADFEYKCTDYYDPSNEGCLIWNDPEVGVKWPVVDPLLSAKDALGKSFSELFTN
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttatcgacacagatgtccttggtgtaaagttggttgagccaaaagtttttggt
gatgatcgtggtttttttcttgagacatttcagcaggatcgttataaaaaaatgttaaat
attgacctggactttgttcaggacaaccattcccgctcttcacaaaatgtattgcgtggg
ctgcatttccaaacatgtaaacctcagggtaagctcgtccgtgttgtgcgaggtgaggtt
tttgatgttgttgttgatatccggccagaatcagaaacttttggtaagtgggtaggggtg
catctttcagaaacaaataaaaatcagctttgggtgccacctggtctcgcgcatggcttt
gttgtcatttcagattttgccgattttgagtacaaatgcactgactactatgatcccagt
aatgaaggatgcttgatctggaacgatcctgaagttggcgtaaaatggccagttgtcgat
cctttgctttctgcaaaagatgcgcttggaaaaagcttctcagagctttttactaactga

DBGET integrated database retrieval system