KEGG   Rahnella aquatilis HX2: Q7S_10385Help
Entry
Q7S_10385         CDS       T01850                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
raa  Rahnella aquatilis HX2
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q7S_10385
Enzymes [BR:raa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Q7S_10385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2287326..2288105)
Genome map
AA seq 259 aa AA seqDB search
MTHPKVRAAIALQGAHLLAWQPEGEEPVLWMSSASAFKEGVAIRGGIPICWPWFGPAGKP
SHGFARNVAWELTDHKETDEDVVLTLTLKSSPETLELWPHAFTLTARFTLGATCHIELES
TGDFEANSALHTYFNIGDIADVTIKGLGNSFIDKVDGAKTKQEDGDLTFTGQTDRIYTQP
QATSEIVDPVLKRTLVVAHENNADVVAWNPGSALSVSMADMPDDGYKTMVCVETAQVSHT
HTSTHAAPARLAVTFSVRK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgactcatccgaaagtacgtgctgccattgccctgcaaggtgcacatctgttggcatgg
cagcctgaaggcgaagagccggtgctatggatgagcagcgccagcgcgttcaaagaaggc
gttgcgattcgtggcggtatccctatctgctggccgtggtttggtccggcgggcaaaccc
tcacacggttttgcacgtaacgttgcgtgggaactgactgaccacaaagaaactgacgaa
gatgtggtactgaccttaacgctgaaaagctcccctgaaacactggaattatggccgcat
gcattcacgctgacggcacgcttcacgctcggggcaacctgccacatcgagctggaatca
accggtgatttcgaagccaacagcgccctgcacacctatttcaacattggcgacatcgcc
gatgtcactattaaaggcctgggcaacagctttattgataaagtcgatggcgcaaaaacc
aagcaggaagacggtgatctgaccttcacgggccagactgaccgcatctacacccagccg
caagccaccagcgaaatcgttgatccggttctgaaacgtacgctggttgtcgcacatgaa
aataacgccgatgtggtggcctggaatccgggttctgcactgtcggtgagcatggctgat
atgccggatgacggatataaaaccatggtgtgcgttgaaacggcgcaagtttcccataca
cacacctctacgcatgccgcgccagcgcgtctggcagtgaccttctctgtccgtaaataa

DBGET integrated database retrieval system