KEGG   Rahnella aquatilis HX2: Q7S_10405Help
Entry
Q7S_10405         CDS       T01850                                 

Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
raa  Rahnella aquatilis HX2
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Q7S_10405
Enzymes [BR:raa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Q7S_10405
    3.5.1.-  
     Q7S_10405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2290558..2291187)
Genome map
AA seq 209 aa AA seqDB search
MKSALLLVDLQNDFCRRGALAVTDGDATIAVANKMMTWCKSHDIAVVASQDWHPAGHRSF
AVNSHAEPWTSGELNGLPQVWWPVHCVQREPGAEFHPGLNLPQVDFVVQKGTNPDIDSYS
AFFDNGHRAATMLNDWLKAAQITHLYVMGLATDYCVKFTVLDALEQGYQVTLLTDGCRGV
NLQPEDSAEAVEAMRKAGAKISTSEAVTG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgctttgttgctggtcgatctgcaaaatgatttttgtcgcagaggcgcgctg
gccgtgactgacggcgacgccacgattgcggttgccaataagatgatgacatggtgtaaa
agccatgacatcgccgtggtggcatcgcaggactggcatccggcgggacatcgcagcttt
gcggtgaattcccacgcggagccctggacgtcgggcgaactgaacggtctgccgcaagtc
tggtggccggttcactgcgttcagcgtgaaccgggcgctgaatttcacccggggctgaat
ctgccgcaggtggattttgtggtgcagaaaggcaccaatcctgacatcgacagttacagt
gcgtttttcgataacggacatcgcgctgctacgatgctcaatgactggctgaaagcggcg
cagattacacatttgtatgtgatggggctggcgacggattactgtgtgaaattcacggtg
ctggatgcgctggagcaaggttatcaggtgacactgctgaccgacggttgccgtggcgtc
aatctgcaacccgaagacagtgctgaagcggttgaagcgatgcgtaaagcaggggcaaaa
atcagtacctctgaggcagtaacaggctga

DBGET integrated database retrieval system