KEGG   Rahnella aquatilis HX2: Q7S_11730Help
Entry
Q7S_11730         CDS       T01850                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase
Organism
raa  Rahnella aquatilis HX2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2606680..2607678
Genome map
AA seq 332 aa AA seqDB search
MKQADDFERVSLGFFPTPLERLSTLGDSLGITLDIKRDDYTGFGGGGNKVRKLEYLMADA
CRKQVNVVITTGGHQSNHARMVAAAARKFGMKPVLVLRGHQPETYQGNLLLDKLFGAELE
FLDPDGYFTQIEGAMNAHADAAQERGEKALIIPLGGATPLGALGYVRAIEEMDAQLKERH
QLPPDVIVAPTGSGGTLAGLYVGARKYWPDTKIVGISVSAKAEWFRTRISAMAQDCADLL
EWPQHWTPDDIWIEDEFVGTAYGVPSDGGIDAIYRVAQAEGLLLDPVYTGKAMHGLISLV
EQGKISAGSRVIFVHCGGSPALYPFAQTLLEH
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagcagatgattttgaacgtgtttcactgggattcttccccacaccgctcgaa
cgcctgagcacactcggcgactcactcggcatcacgctggatatcaaacgtgatgattac
accggcttcggcggcggcggtaataaagtccgcaaactggaatatctgatggccgatgcc
tgccgcaagcaggtcaatgtggttatcaccaccggcgggcatcagtccaaccatgcccgg
atggtggcggcggcggcgcgtaagttcggcatgaaaccggtgctggtgctgcgcggccat
cagccggaaacctatcagggcaatcttctgctcgataaactgttcggcgcggagctggag
tttctcgaccctgacggctatttcacccagattgaaggggcgatgaatgcccatgccgac
gcggcacaggaacgcggtgaaaaagcgctgattatcccgctcggcggcgccacgccgctc
ggcgcattgggttatgtgcgcgctatcgaagaaatggacgcccagcttaaagaacgtcat
cagttgccgcctgacgtgattgtcgcgccgaccggttccggcggtacgctggccgggctg
tatgtcggcgcacgtaaatactggccggacaccaaaatcgtgggtatcagcgtcagcgcc
aaagcggaatggttccggacacgaatttccgccatggcgcaggattgtgctgatttgctg
gaatggccacaacactggacgcctgacgatatctggattgaagacgaatttgtcggcacc
gcctacggcgtgccgtctgacggcggcattgatgccatctaccgtgttgcgcaggccgaa
ggtttgctgctggatccggtctacaccggcaaagccatgcacgggctgatcagtctggtg
gagcaaggcaaaatcagcgccggttcacgggtgattttcgtgcactgtggcggctcaccg
gcgctgtatccctttgcacagaccttgctggagcactga

DBGET integrated database retrieval system