KEGG   Rahnella aquatilis HX2: Q7S_11935Help
Entry
Q7S_11935         CDS       T01850                                 

Definition
(RefSeq) Enoyl-CoA hydratase/isomerase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
raa  Rahnella aquatilis HX2
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Q7S_11935
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Q7S_11935
   00650 Butanoate metabolism
    Q7S_11935
  Lipid metabolism
   00071 Fatty acid degradation
    Q7S_11935
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Q7S_11935
   00310 Lysine degradation
    Q7S_11935
   00360 Phenylalanine metabolism
    Q7S_11935
   00380 Tryptophan metabolism
    Q7S_11935
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Q7S_11935
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Q7S_11935
   00281 Geraniol degradation
    Q7S_11935
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Q7S_11935
   00627 Aminobenzoate degradation
    Q7S_11935
   00930 Caprolactam degradation
    Q7S_11935
Enzymes [BR:raa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Q7S_11935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2646020..2646790)
Genome map
AA seq 256 aa AA seqDB search
MSELIRCERHQGVAHIILNRPEKLNALSAEMLTQLLEKMRELDGDKQIRAMVISGSARAF
AAGADTGTLATASAIALYTSGFSEKWDQIAAIETPVVAALSGYALGGGLELALLCDIVIA
DDTAIIGLPETHIGIIPGAGGTQRLVKSVGKSLAMEIILAGRKITATEALAAGLISRVTT
PETLTEQALKIAQNISRAAPLAVKMAKKAVLASFDMGLTAGISYERSLSALIAASDDRSE
GMRALAAKEQAAFTGK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacttatccgctgtgaacgtcatcagggcgtggcgcatatcattcttaaccgg
ccggaaaaacttaatgcgctgagtgcagaaatgctgacgcaattgctggagaaaatgcgc
gaactggacggtgataaacagatccgcgcgatggtgatttccggctccgcgcgtgcgttt
gctgcgggtgccgataccggcacgctggccaccgcctcagcgatagccctttacaccagc
ggtttcagtgaaaagtgggatcagattgccgccattgaaacgccggttgtcgcggcgtta
tccggttatgcactgggcggcgggctggaactggcgttgctgtgcgatatcgtgattgcc
gatgacacggccatcatcgggctgccggaaacgcacatcgggattatccccggcgcgggt
ggcacgcagcggctggttaaatcggtggggaaatcactggcgatggaaatcatcctcgcc
gggcgaaaaatcaccgccacagaagcgctggccgccggactgatcagtcgtgtcaccacg
ccggaaacgttaacggaacaggcgttaaagattgcgcagaatatttcccgtgccgcaccg
ctcgccgttaagatggccaaaaaagccgtgctggcgagtttcgatatgggcttaacggcg
ggcatcagttatgaacgttcgttgtcggccctgattgcggccagtgacgaccgcagcgaa
ggcatgcgtgcactggcggcgaaagaacaggcggcgtttaccggcaaataa

DBGET integrated database retrieval system