KEGG   Rahnella aquatilis HX2: Q7S_11935Help
Entry
Q7S_11935         CDS       T01850                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00071  Fatty acid degradation
raa00280  Valine, leucine and isoleucine degradation
raa00281  Geraniol degradation
raa00310  Lysine degradation
raa00360  Phenylalanine metabolism
raa00362  Benzoate degradation
raa00380  Tryptophan metabolism
raa00410  beta-Alanine metabolism
raa00627  Aminobenzoate degradation
raa00640  Propanoate metabolism
raa00650  Butanoate metabolism
raa00903  Limonene and pinene degradation
raa00930  Caprolactam degradation
raa01100  Metabolic pathways
raa01110  Biosynthesis of secondary metabolites
raa01120  Microbial metabolism in diverse environments
raa01130  Biosynthesis of antibiotics
raa01212  Fatty acid metabolism
Module
raa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Q7S_11935
   00650 Butanoate metabolism
    Q7S_11935
  Lipid metabolism
   00071 Fatty acid degradation
    Q7S_11935
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Q7S_11935
   00310 Lysine degradation
    Q7S_11935
   00360 Phenylalanine metabolism
    Q7S_11935
   00380 Tryptophan metabolism
    Q7S_11935
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Q7S_11935
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Q7S_11935
   00281 Geraniol degradation
    Q7S_11935
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Q7S_11935
   00627 Aminobenzoate degradation
    Q7S_11935
   00930 Caprolactam degradation
    Q7S_11935
Enzymes [BR:raa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Q7S_11935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 SDH_sah
Motif
Other DBs
NCBI-ProteinID: AFE58612
UniProt: H8NQG2
Position
complement(2646020..2646790)
Genome map
AA seq 256 aa AA seqDB search
MSELIRCERHQGVAHIILNRPEKLNALSAEMLTQLLEKMRELDGDKQIRAMVISGSARAF
AAGADTGTLATASAIALYTSGFSEKWDQIAAIETPVVAALSGYALGGGLELALLCDIVIA
DDTAIIGLPETHIGIIPGAGGTQRLVKSVGKSLAMEIILAGRKITATEALAAGLISRVTT
PETLTEQALKIAQNISRAAPLAVKMAKKAVLASFDMGLTAGISYERSLSALIAASDDRSE
GMRALAAKEQAAFTGK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacttatccgctgtgaacgtcatcagggcgtggcgcatatcattcttaaccgg
ccggaaaaacttaatgcgctgagtgcagaaatgctgacgcaattgctggagaaaatgcgc
gaactggacggtgataaacagatccgcgcgatggtgatttccggctccgcgcgtgcgttt
gctgcgggtgccgataccggcacgctggccaccgcctcagcgatagccctttacaccagc
ggtttcagtgaaaagtgggatcagattgccgccattgaaacgccggttgtcgcggcgtta
tccggttatgcactgggcggcgggctggaactggcgttgctgtgcgatatcgtgattgcc
gatgacacggccatcatcgggctgccggaaacgcacatcgggattatccccggcgcgggt
ggcacgcagcggctggttaaatcggtggggaaatcactggcgatggaaatcatcctcgcc
gggcgaaaaatcaccgccacagaagcgctggccgccggactgatcagtcgtgtcaccacg
ccggaaacgttaacggaacaggcgttaaagattgcgcagaatatttcccgtgccgcaccg
ctcgccgttaagatggccaaaaaagccgtgctggcgagtttcgatatgggcttaacggcg
ggcatcagttatgaacgttcgttgtcggccctgattgcggccagtgacgaccgcagcgaa
ggcatgcgtgcactggcggcgaaagaacaggcggcgtttaccggcaaataa

DBGET integrated database retrieval system