KEGG   Rahnella aquatilis HX2: Q7S_12485Help
Entry
Q7S_12485         CDS       T01850                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
raa  Rahnella aquatilis HX2
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:raa00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2777367..2778395)
Genome map
AA seq 342 aa AA seqDB search
MRQGNIVPAKISLLKTRLEAFDRIDLLGSATPLEKLHRLSEYAGRDIYIKRDDITPLAMG
GNKLRKLEYLAAAALAEGADTLVTAGAIQSNHVRQTAAVAAKLGLKCVALLENPIGTTEV
NYLSNGNRLLLDLFNVEVVMCDALDDPMAQLAEQAERLEAQGFRPYVVPVGGSNALGALG
YVQCALEIAEQSSASFVDFSAVVVASGSAGTHAGLAVALQHLMPDTQLIGVTVSRSADAQ
RPKVEAIAREVTTQLQLGEKTPSITLWDEYFAPRYGEPNEAGTAAVKLLAEQEAMLLDPV
YTGKAMAGLLDGIARGLFPDEGPILFIHTGGAPALFAYHPQV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtcaggggaacatcgtgcctgctaaaatttctttgcttaaaacccggctggaagcc
ttcgatcggatcgatttactgggcagcgccacgccgctggaaaaactgcatcgtctttcc
gaatacgccggacgtgacatttacattaaacgcgatgacatcacgccgctggcgatgggc
ggtaacaagctgcgcaaactggaatatctggccgccgcagcgctggcagaaggtgcggat
acactggtgaccgctggtgccattcagtcaaatcatgtacgccagaccgccgccgtggcc
gccaaactgggcctgaaatgcgttgcgttgctggaaaacccgatcggcaccaccgaagtc
aattatctgagcaacggcaaccgtctgctgctggatctgttcaatgtggaagtggtgatg
tgcgatgcgcttgatgacccgatggcgcagcttgcagaacaagccgaacgtctggaagca
caaggttttcgtccctacgtcgtgccggttggcggttccaatgcgcttggtgcactcggc
tacgtgcagtgcgcgctggaaatcgccgagcagtcttcggccagttttgtggatttcagt
gccgtggtggtggcatcgggcagcgccggtacgcacgctggtctggccgtcgctttgcaa
catttaatgccagacacgcaattgattggtgtgacagtgtcgcgcagtgccgatgcccag
cgtcccaaagttgaagccattgcccgggaagtgacaacacaattacaactgggtgagaaa
acgccgtcaattaccttgtgggacgaatattttgcgccacgctacggtgagccaaatgaa
gccggaaccgccgccgtgaaattgctggcagagcaggaagccatgctgctggatccggtg
tataccggcaaagcgatggccggattgctcgacggtatagcgcgtggtttgttcccggat
gaaggcccgatcctgttcattcataccggcggtgcaccggcactgtttgcgtatcatccg
caggtttaa

DBGET integrated database retrieval system