KEGG   Rahnella aquatilis HX2: Q7S_12485Help
Entry
Q7S_12485         CDS       T01850                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
raa  Rahnella aquatilis HX2
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Q7S_12485
Enzymes [BR:raa01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Q7S_12485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2777367..2778395)
Genome map
AA seq 342 aa AA seqDB search
MRQGNIVPAKISLLKTRLEAFDRIDLLGSATPLEKLHRLSEYAGRDIYIKRDDITPLAMG
GNKLRKLEYLAAAALAEGADTLVTAGAIQSNHVRQTAAVAAKLGLKCVALLENPIGTTEV
NYLSNGNRLLLDLFNVEVVMCDALDDPMAQLAEQAERLEAQGFRPYVVPVGGSNALGALG
YVQCALEIAEQSSASFVDFSAVVVASGSAGTHAGLAVALQHLMPDTQLIGVTVSRSADAQ
RPKVEAIAREVTTQLQLGEKTPSITLWDEYFAPRYGEPNEAGTAAVKLLAEQEAMLLDPV
YTGKAMAGLLDGIARGLFPDEGPILFIHTGGAPALFAYHPQV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtcaggggaacatcgtgcctgctaaaatttctttgcttaaaacccggctggaagcc
ttcgatcggatcgatttactgggcagcgccacgccgctggaaaaactgcatcgtctttcc
gaatacgccggacgtgacatttacattaaacgcgatgacatcacgccgctggcgatgggc
ggtaacaagctgcgcaaactggaatatctggccgccgcagcgctggcagaaggtgcggat
acactggtgaccgctggtgccattcagtcaaatcatgtacgccagaccgccgccgtggcc
gccaaactgggcctgaaatgcgttgcgttgctggaaaacccgatcggcaccaccgaagtc
aattatctgagcaacggcaaccgtctgctgctggatctgttcaatgtggaagtggtgatg
tgcgatgcgcttgatgacccgatggcgcagcttgcagaacaagccgaacgtctggaagca
caaggttttcgtccctacgtcgtgccggttggcggttccaatgcgcttggtgcactcggc
tacgtgcagtgcgcgctggaaatcgccgagcagtcttcggccagttttgtggatttcagt
gccgtggtggtggcatcgggcagcgccggtacgcacgctggtctggccgtcgctttgcaa
catttaatgccagacacgcaattgattggtgtgacagtgtcgcgcagtgccgatgcccag
cgtcccaaagttgaagccattgcccgggaagtgacaacacaattacaactgggtgagaaa
acgccgtcaattaccttgtgggacgaatattttgcgccacgctacggtgagccaaatgaa
gccggaaccgccgccgtgaaattgctggcagagcaggaagccatgctgctggatccggtg
tataccggcaaagcgatggccggattgctcgacggtatagcgcgtggtttgttcccggat
gaaggcccgatcctgttcattcataccggcggtgcaccggcactgtttgcgtatcatccg
caggtttaa

DBGET integrated database retrieval system