KEGG   Rahnella aquatilis HX2: Q7S_13050Help
Entry
Q7S_13050         CDS       T01850                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
raa  Rahnella aquatilis HX2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Q7S_13050
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q7S_13050
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Q7S_13050
Enzymes [BR:raa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Q7S_13050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2885859..2887049
Genome map
AA seq 396 aa AA seqDB search
MTLLNPYFGEFGGQYVPQILMPALAQLEEAFVSAQRDPEFQAEFIDLLKNYAGRPTALTL
CKNLTAGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSSTLKDACNEALRDWSGSY
EKAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQMQEREGCLPDAVIACVGGGSNAIGMF
ADFIDDTSVKLIGVEPGGLGIETGQHGAPLKHGHVGIYFGMKAPMMQTSEGQIEESYSIS
AGLDFPSVGPQHAFLNSIGRAEYVSITDDEALDAFKELSRHEGIIPALESSHALAYALKL
IKETPEKEQILVVNLSGRGDKDIFTVHDILTARGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgactttacttaatccctactttggcgaatttggcggccagtatgtcccgcaaattctg
atgcctgcgctggctcagctggaagaagcttttgtcagcgcacagcgcgaccctgagttt
caggccgaattcattgatttactgaaaaactacgcaggccgcccgaccgccctgacgttg
tgtaaaaacctgaccgcaggcaccaaaaccaagctgtaccttaagcgtgaagatttgctg
cacggcggcgcgcacaaaactaaccaggtgttgggtcaggcattactggccaaacgcatg
ggcaaaactgaaatcatcgccgaaaccggcgcgggtcagcacggcgtggcatcggcactg
gcctgtgcgctgctcggcctgaaatgccgcatttatatgggcgcaaaagacattgagcgt
cagtcgccaaacgtgttccgtatgcgtctgatgggggctgaagtgattccggtacatagc
ggttcttccacgctgaaagatgcctgtaatgaggcgctgcgtgactggtccggcagctat
gaaaaagcccactacatgctgggcacggcagcaggcccgcatccgtatccgaccatcgtg
cgtgaattccagcgtatgatcggcgaagaaaccaaagcgcagatgcaggaacgcgaaggc
tgcctgccggatgcggtgattgcctgcgtcggcggcggctccaatgcgatcggtatgttt
gcggatttcatcgacgacaccagcgtgaagctgattggcgttgaaccgggtggtctgggc
attgaaaccggacaacacggcgcgccgctcaaacacggtcacgtcggcatttacttcggc
atgaaagcaccgatgatgcagacgtctgagggtcagattgaagaatcctactcgatttca
gccggtctggatttcccgtccgtcggcccgcaacacgcttttctcaacagcattggccgt
gcagaatatgtgtcgattaccgatgatgaagcgctggatgcctttaaagaattgtcccgc
catgaagggattattcctgcactggaatcctctcatgcgctggcttacgcgctgaaactg
atcaaggaaacaccagagaaagaacaaatcctggtcgtgaatttgtcaggtcgcggcgac
aaagacattttcaccgtacacgacatcctgactgcccggggagagatttaa

DBGET integrated database retrieval system