KEGG   Rahnella aquatilis HX2: Q7S_13055Help
Entry
Q7S_13055         CDS       T01850                                 

Definition
(GenBank) TspO and MBR-like protein
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
raa  Rahnella aquatilis HX2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Q7S_13055
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q7S_13055
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Q7S_13055
Enzymes [BR:raa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Q7S_13055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2887049..2887855
Genome map
AA seq 268 aa AA seqDB search
MERYQQLFKRLESKKEGAFVPFVTLGDPGVELSLSIIDTLIEAGADALELGVPFSDPLAD
GPTIQNANLRAFAAGVTPTQCFNMLARIREKHPDIPIGLLMYANLVFHNGIETFYQRCAE
VGVDSVLVADVPFEESAPFRAAALRHGIAPIFICPPNASDDLLREISSHGRGYTYLLSRA
GVTGTEKRALTPLNHLVDKLREYNAAPPLQGFGISEPSQVKETLAAGAAGAISGSATVRI
IENNQHQPSEMLAQLSRFVSEMKAATRA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttatcagcaattattcaagcgtctggaaagcaaaaaagaaggcgcatttgtt
cctttcgtcacgctgggcgatccgggcgttgagctgtcactgtcaatcatcgatacgctg
atcgaagccggtgccgacgcactggaactgggtgtaccgttctccgatcctctggccgat
ggcccgaccattcagaatgcaaatctgcgtgcttttgctgcgggtgtgacgccaacgcaa
tgcttcaacatgctggcccgtattcgcgaaaagcatccggatattccgattggcctgctg
atgtatgccaacctggtgttccacaatggtattgaaaccttctatcagcgttgcgctgaa
gtgggcgtcgattcggtgctggttgccgatgtgccgtttgaagaatctgcgccattccgt
gcggccgcgttacgccacggcatcgctcctatcttcatctgtccgccaaatgcctctgac
gatttgctgcgtgagatttcgtctcatggccgcggatacacttacttgctgtcacgtgca
ggcgtgacaggcactgaaaaacgcgcgctgacgccgctgaatcacttggttgataagtta
cgtgaatacaatgccgcgccacccttgcagggctttggtatttccgaaccttcacaggtg
aaagaaacgctggccgcaggcgcagccggtgctatttccggttcagcgacggtgcgtatc
atcgaaaacaatcagcatcagccttctgaaatgctggctcagctttcccgctttgtcagt
gaaatgaaggccgcgacccgcgcttaa

DBGET integrated database retrieval system