KEGG   Rahnella aquatilis HX2: Q7S_13165Help
Entry
Q7S_13165         CDS       T01850                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
raa  Rahnella aquatilis HX2
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Q7S_13165
Enzymes [BR:raa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Q7S_13165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2907172..2907780)
Genome map
AA seq 202 aa AA seqDB search
MAQLYFYYSAMNAGKSTSLLQSSYNYQERGMRTLVLTAELDNRYGQGKVSSRIGLSSPAE
LYNTETELFNLVAQENRTQRLSCVLIDECQFLTKAQVSQLTDVVDDLDVPVLCYGLRTDF
RGELFEGSEYLLAWADKLVELKTICHCGRKANRNLRLDENGNALHDGAQVVIGGDESYVS
VCRKHYKEAMAAFDGRDESKTL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggctcagctttatttctattactcggcgatgaatgccggtaagtccacctcgttgctg
caatcttcatataattatcaagaacgtggtatgcgcacgctggtgttaacagcagaactc
gataaccggtatggtcagggtaaagtcagttcgcgaatcggcttgtcgtctcctgcagag
ctttacaacacagagacagaactcttcaatctggtggctcaggagaaccgcacacagcgt
ttgagttgcgttctgattgatgagtgccagtttctcaccaaagctcaggtatcgcagctg
acggacgttgtggacgatctggatgtgcctgtactttgctatggtctgagaacggatttt
cgcggagaactttttgagggcagtgaatatctgctggcctgggcggataaactggttgag
cttaaaaccatctgccattgtggtcgcaaagccaaccgcaacctgagactggatgagaac
ggtaacgccttacatgatggcgcacaggtcgttattggcggtgatgaaagttatgtttcg
gtctgccgtaagcattacaaagaagcgatggctgcgtttgatggcagggatgaaagtaag
actctctaa

DBGET integrated database retrieval system