KEGG   Rahnella aquatilis HX2: Q7S_14250Help
Entry
Q7S_14250         CDS       T01850                                 

Gene name
btuE
Definition
(GenBank) putative glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00480  Glutathione metabolism
raa00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Q7S_14250 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Q7S_14250 (btuE)
Enzymes [BR:raa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Q7S_14250 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AFE59065
UniProt: H8NX25
Position
complement(3135005..3135556)
Genome map
AA seq 183 aa AA seqDB search
MSNEIYNISLKTIDGETTTLGAYKGSVLLVVNVASQCGLTRQYEGLENIYQAWHDRGFEV
LGFPCNEFGAQEPGTEDEIKTFCTTHFGVKFPMFSKINVNGDNRHPLYSALIAACPTAVK
PEDSAFYERLASKGRQPLKPDDILWNFEKFLIGRDGTVVQRFAPDMTPEDPILMETIKAA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgaaatttataatatctccctgaaaactatcgatggcgaaaccacgacgctc
ggtgcttataaaggttctgtattgctggtcgtgaatgtggcatcacaatgtggcctgacc
aggcaatatgaggggctggaaaatatctaccaggcctggcacgatcgtggttttgaagtg
ctggggttcccgtgcaatgaattcggcgcgcaggaaccgggcactgaagatgagatcaaa
accttctgcaccacccattttggcgtgaaattcccgatgtttagcaaaattaacgtcaac
ggagacaaccgtcatccgctgtattcagcgctgattgcagcctgtccgacagccgtcaaa
ccggaagacagtgcgttctacgaacgtctggccagcaaaggtcgtcaacctcttaagccc
gatgacatcttgtggaactttgagaaattcctgattggtcgtgacggcaccgtggttcag
cgttttgcacccgatatgacaccggaagatccgatccttatggaaaccatcaaagccgca
ctggcgaaataa

DBGET integrated database retrieval system