KEGG   Rahnella aquatilis HX2: Q7S_14445Help
Entry
Q7S_14445         CDS       T01850                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
raa  Rahnella aquatilis HX2
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Q7S_14445
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q7S_14445
  Lipid metabolism
   00071 Fatty acid degradation
    Q7S_14445
  Amino acid metabolism
   00350 Tyrosine metabolism
    Q7S_14445
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Q7S_14445
   00626 Naphthalene degradation
    Q7S_14445
Enzymes [BR:raa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Q7S_14445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3180705..3181331)
Genome map
AA seq 208 aa AA seqDB search
MKAAVVNKDHSVDVVEKTLRDLEHGEALLEMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGIDVNDQQLEFAADMGADLTINMRKDDAAKIIQEKVGGAHAAVVTATAKSAFNSAVDAM
RAGGRIVAVGLPPESMSLNIPRLVLDGIQVVGSLVGTREDLAEAFQFAAEGKVVPKVTKR
PLGDINAIFQEMEQGKIKGRMVIDFTHK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgttgtgaataaagaccactctgtggacgtcgtggagaagactctgcgc
gacctggaacatggtgaggcacttttggaaatggagtgctgtggtgtatgtcatacggat
ttgcatgtcaaaaacggtgatttcggtgacaaaaccggcgtaatcctcgggcatgaaggg
atcggtattgatgttaatgatcagcaactggagtttgccgccgatatgggggctgacctg
accattaatatgcggaaagacgatgcagcaaaaattattcaggagaaagtcggtggcgct
catgctgcggtggtaacagcaacggcgaaatccgcttttaactccgcagtggatgcgatg
cgcgctggcggtcgtattgtcgccgtgggtttaccgccggaatccatgagcctgaatatt
cctcgtctggtgcttgacggcattcaggtcgtcggttcactggtcggtacccgtgaagat
ctggctgaggctttccagtttgccgctgaaggtaaagtggtgccgaaagtcacaaagcgt
ccgctgggcgatatcaatgcgatcttccaggaaatggaacaaggcaaaattaaaggcaga
atggtgatcgactttacgcataagtaa

DBGET integrated database retrieval system