KEGG   Rahnella aquatilis HX2: Q7S_15745Help
Entry
Q7S_15745         CDS       T01850                                 

Definition
galactose mutarotase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
raa  Rahnella aquatilis HX2
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:raa00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:raa00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3440326..3441372
Genome map
AA seq 348 aa AA seqDB search
MLKPENTQLAPDGQPFEQVTLQNAAGATATFMDWGATWLSFTLPLTDGSTRELLLGCQSL
QEYMNQSAYLGATVGRYANRIARSQFDIDGKPHLVVANQGVHQLHGGPEGFHARRWTILE
QTAQKLTFQLFSADGDQGYPGNMTAKVHYQLTDDNRLEIRYEATVDKLCPVNLTNHAYFN
LDGEGTDARQHKLQLFADRFLPVDSDGIPCADPTPVENTGMNFNAAKTLAKDFLTDRDQQ
RVKGYDHAYLLNRTCNSGSNPAAHLWSADGKVKMTMFTSAPAVQLYSGNFLGGTPNRSGG
EYASYSGVALESEFLPDSPNHATWPQPSCWVKPGQTYKSSTTYQFFAL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaacctgaaaacacgcaactggcgcccgatggccagccgtttgaacaggttacg
ctacagaatgcggcaggtgccaccgccacattcatggactggggcgcgacctggttatcc
tttaccctgccgctgacagatggctccacgcgtgaactgctgctgggctgccagtcactg
caggaatacatgaaccagagcgcgtatctgggcgcgaccgtcggacgttatgccaaccgt
atcgcccgctcgcagtttgatattgacggcaaaccgcatctggtggtcgccaatcagggc
gtgcatcagcttcacggcgggccggaaggtttccatgcgcgtcgctggactattctcgaa
cagaccgcgcagaagctgacgttccagctattttcggccgacggcgatcagggttatccg
ggcaacatgacggcgaaagtgcattaccagctgactgacgataaccgtctggaaatccgt
tacgaagcgacggttgataagctgtgcccggtcaatctgaccaatcatgcctatttcaat
ctcgacggcgaaggcaccgatgcgcgccagcacaagctgcaactgtttgcggaccgtttc
ctgccggtcgacagcgatggcattccctgtgcggatccgaccccggttgaaaacaccggc
atgaatttcaacgcagccaaaacgctggcgaaagatttcctcaccgaccgcgaccagcaa
cgcgtgaaaggctatgaccacgcctatctgctcaaccgcacctgcaacagcggcagcaat
ccggcagcgcatttgtggtctgccgacggcaaagtcaaaatgacaatgtttacgtctgcg
cccgccgtgcaactctacagcggtaatttcctgggcggaacaccgaaccgcagcggcggt
gaatacgccagttacagcggtgtcgcgctggaaagcgaatttctgccggacagcccgaat
cacgccacctggccgcaaccgagctgctgggtcaaaccgggtcagacgtataagtcctcg
acgacgtatcagttcttcgcgttgtaa

DBGET integrated database retrieval system