KEGG   Rahnella aquatilis HX2: Q7S_15755Help
Entry
Q7S_15755         CDS       T01850                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00010  Glycolysis / Gluconeogenesis
raa00260  Glycine, serine and threonine metabolism
raa00680  Methane metabolism
raa01100  Metabolic pathways
raa01110  Biosynthesis of secondary metabolites
raa01120  Microbial metabolism in diverse environments
raa01130  Biosynthesis of antibiotics
raa01200  Carbon metabolism
raa01230  Biosynthesis of amino acids
Module
raa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
raa_M00002  Glycolysis, core module involving three-carbon compounds
raa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q7S_15755 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Q7S_15755 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q7S_15755 (gpmA)
Enzymes [BR:raa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Q7S_15755 (gpmA)
Membrane trafficking [BR:raa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Q7S_15755 (gpmA)
Exosome [BR:raa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Q7S_15755 (gpmA)
  Exosomal proteins of melanoma cells
   Q7S_15755 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFE59364
UniProt: H8NXG6
Position
3442064..3442816
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESEWNKENRFTGWHDVELSDKGRTEAKAAGQLLKDEGFQFDFAYTSVL
KRAIHTLWSVLDELNQPWLPVEKSWKLNERHYGALQGLDKAETAQKYGDEQVKQWRRGFA
VTPPELDRADERFPGHDPRYAKLTAAELPTTESLALTIERVIPYWTEVIKPRIASGERVI
IAAHGNSLRALVKYLDDLSEEEILELNIPTGVPLVYEFDENYKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaccaagctggtgctggtaagacacggtgagagtgagtggaataaagaaaac
cgctttaccggttggcatgatgttgaactgtccgataagggccgcaccgaagcaaaagct
gctggtcagctgctgaaagacgaaggcttccaattcgattttgcatacacctctgtgctg
aaacgtgccatccacacactgtggagcgttttggacgaactgaaccagccatggctgcca
gttgagaaatcctggaaactgaacgaacgtcattacggtgcgttgcagggtctggataaa
gcagaaactgcacagaaatacggtgacgagcaagttaaacaatggcgtcgtggttttgct
gtgacgccaccagaactggatcgcgctgacgaacgtttccctggccacgacccacgttac
gctaaactgactgcggcagaactgccaacgacagaaagcctggcgctgaccatcgaacgc
gtcatcccttactggactgaagtgatcaaaccacgcatcgccagcggcgagcgcgtcatc
atcgcggcacacggtaattccctgcgcgcactggttaaatatctcgacgacctgagcgaa
gaagaaattctggaactgaacatccctaccggtgttccactggtttacgagtttgacgaa
aactacaaaccaatcaaacgttactatctgggtaatgccgacgaaatcgcagcgaaagca
gcggccgtggcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system