KEGG   Rahnella aquatilis HX2: Q7S_15755Help
Entry
Q7S_15755         CDS       T01850                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
raa  Rahnella aquatilis HX2
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:raa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Q7S_15755 (gpmA)
   01230 Biosynthesis of amino acids
    Q7S_15755 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q7S_15755 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Q7S_15755 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q7S_15755 (gpmA)
Enzymes [BR:raa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Q7S_15755 (gpmA)
Exosome [BR:raa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Q7S_15755 (gpmA)
  Exosomal proteins of melanoma cells
   Q7S_15755 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3442064..3442816
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESEWNKENRFTGWHDVELSDKGRTEAKAAGQLLKDEGFQFDFAYTSVL
KRAIHTLWSVLDELNQPWLPVEKSWKLNERHYGALQGLDKAETAQKYGDEQVKQWRRGFA
VTPPELDRADERFPGHDPRYAKLTAAELPTTESLALTIERVIPYWTEVIKPRIASGERVI
IAAHGNSLRALVKYLDDLSEEEILELNIPTGVPLVYEFDENYKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaccaagctggtgctggtaagacacggtgagagtgagtggaataaagaaaac
cgctttaccggttggcatgatgttgaactgtccgataagggccgcaccgaagcaaaagct
gctggtcagctgctgaaagacgaaggcttccaattcgattttgcatacacctctgtgctg
aaacgtgccatccacacactgtggagcgttttggacgaactgaaccagccatggctgcca
gttgagaaatcctggaaactgaacgaacgtcattacggtgcgttgcagggtctggataaa
gcagaaactgcacagaaatacggtgacgagcaagttaaacaatggcgtcgtggttttgct
gtgacgccaccagaactggatcgcgctgacgaacgtttccctggccacgacccacgttac
gctaaactgactgcggcagaactgccaacgacagaaagcctggcgctgaccatcgaacgc
gtcatcccttactggactgaagtgatcaaaccacgcatcgccagcggcgagcgcgtcatc
atcgcggcacacggtaattccctgcgcgcactggttaaatatctcgacgacctgagcgaa
gaagaaattctggaactgaacatccctaccggtgttccactggtttacgagtttgacgaa
aactacaaaccaatcaaacgttactatctgggtaatgccgacgaaatcgcagcgaaagca
gcggccgtggcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system